SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197250012|ref|YP_002148240.1| from Salmonella enterica subsp. enterica serovar Agona str. SL483

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197250012|ref|YP_002148240.1|
Domain Number 1 Region: 14-326
Classification Level Classification E-value
Superfamily SIS domain 1.2e-67
Family mono-SIS domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197250012|ref|YP_002148240.1|
Sequence length 328
Comment D-arabinose 5-phosphate isomerase [Salmonella enterica subsp. enterica serovar Agona str. SL483]
Sequence
MSHLALQPGFDFQQAGKEVLEIEREGLAELDQYINQHFTLACEKMFNCTGKVVVMGMGKS
GHIGRKMAATFASTGTSSFFVHPGEAAHGDLGMVTPQDVVIAISNSGESSEIAALIPVLK
RLHVPLICITGRPESSMARAADVHLCVKVPKEACPLGLAPTTSTTATLVMGDALAVALLK
ARGFTAEDFALSHPGGALGRKLLLRVSDIMHTGDEIPHVNKHATLRDALLEITRKNLGMT
VICDESMKIDGIFTDGDLRRVFDMGGDMRQLGIAEVMTPGGIRVRPGILAVDALNLMQSR
HITSVLVADGDQLLGVLHMHDLLRAGVV
Download sequence
Identical sequences A0A1C2ZX48 A0A1U7FSY3 A0A221YQU4 A0A2I6MUW4 A0A2J9JQP5 B5F6W6 G5Q8A2 G5SHD9
gi|563654668|ref|YP_008862754.1| gi|197250012|ref|YP_002148240.1| WP_000018619.1.100031 WP_000018619.1.10013 WP_000018619.1.100642 WP_000018619.1.100714 WP_000018619.1.100721 WP_000018619.1.10074 WP_000018619.1.100790 WP_000018619.1.100814 WP_000018619.1.100865 WP_000018619.1.100932 WP_000018619.1.100944 WP_000018619.1.101519 WP_000018619.1.101759 WP_000018619.1.101839 WP_000018619.1.101949 WP_000018619.1.10394 WP_000018619.1.10507 WP_000018619.1.10562 WP_000018619.1.10797 WP_000018619.1.11369 WP_000018619.1.11479 WP_000018619.1.11511 WP_000018619.1.11603 WP_000018619.1.11621 WP_000018619.1.12007 WP_000018619.1.12059 WP_000018619.1.12063 WP_000018619.1.12159 WP_000018619.1.12282 WP_000018619.1.12472 WP_000018619.1.12650 WP_000018619.1.13691 WP_000018619.1.13764 WP_000018619.1.13829 WP_000018619.1.13857 WP_000018619.1.14369 WP_000018619.1.14495 WP_000018619.1.14528 WP_000018619.1.14964 WP_000018619.1.15479 WP_000018619.1.15922 WP_000018619.1.15978 WP_000018619.1.16052 WP_000018619.1.16158 WP_000018619.1.16273 WP_000018619.1.16656 WP_000018619.1.16826 WP_000018619.1.16846 WP_000018619.1.17031 WP_000018619.1.17188 WP_000018619.1.1749 WP_000018619.1.17949 WP_000018619.1.18022 WP_000018619.1.18445 WP_000018619.1.18919 WP_000018619.1.19240 WP_000018619.1.19291 WP_000018619.1.19469 WP_000018619.1.20081 WP_000018619.1.20760 WP_000018619.1.20795 WP_000018619.1.21075 WP_000018619.1.21286 WP_000018619.1.21399 WP_000018619.1.21443 WP_000018619.1.21728 WP_000018619.1.21730 WP_000018619.1.21910 WP_000018619.1.22205 WP_000018619.1.22565 WP_000018619.1.22623 WP_000018619.1.2283 WP_000018619.1.23080 WP_000018619.1.23175 WP_000018619.1.23258 WP_000018619.1.23311 WP_000018619.1.23343 WP_000018619.1.23444 WP_000018619.1.23500 WP_000018619.1.23675 WP_000018619.1.237 WP_000018619.1.23720 WP_000018619.1.2380 WP_000018619.1.24450 WP_000018619.1.24686 WP_000018619.1.24696 WP_000018619.1.24837 WP_000018619.1.24839 WP_000018619.1.25064 WP_000018619.1.25205 WP_000018619.1.25297 WP_000018619.1.25514 WP_000018619.1.25546 WP_000018619.1.25809 WP_000018619.1.2667 WP_000018619.1.26883 WP_000018619.1.26892 WP_000018619.1.27055 WP_000018619.1.272 WP_000018619.1.2723 WP_000018619.1.27535 WP_000018619.1.28002 WP_000018619.1.28073 WP_000018619.1.28116 WP_000018619.1.28267 WP_000018619.1.28673 WP_000018619.1.28811 WP_000018619.1.28830 WP_000018619.1.28977 WP_000018619.1.29732 WP_000018619.1.30170 WP_000018619.1.30213 WP_000018619.1.30331 WP_000018619.1.30425 WP_000018619.1.30696 WP_000018619.1.30823 WP_000018619.1.3089 WP_000018619.1.30934 WP_000018619.1.31011 WP_000018619.1.31155 WP_000018619.1.31198 WP_000018619.1.3127 WP_000018619.1.32056 WP_000018619.1.32170 WP_000018619.1.32368 WP_000018619.1.32545 WP_000018619.1.32629 WP_000018619.1.3278 WP_000018619.1.32930 WP_000018619.1.33659 WP_000018619.1.33693 WP_000018619.1.34084 WP_000018619.1.34703 WP_000018619.1.34707 WP_000018619.1.34745 WP_000018619.1.34801 WP_000018619.1.34881 WP_000018619.1.35035 WP_000018619.1.35075 WP_000018619.1.35494 WP_000018619.1.35835 WP_000018619.1.36229 WP_000018619.1.36512 WP_000018619.1.36592 WP_000018619.1.3688 WP_000018619.1.36885 WP_000018619.1.37021 WP_000018619.1.37147 WP_000018619.1.37158 WP_000018619.1.3728 WP_000018619.1.3751 WP_000018619.1.37610 WP_000018619.1.37719 WP_000018619.1.37965 WP_000018619.1.38055 WP_000018619.1.38113 WP_000018619.1.3828 WP_000018619.1.38322 WP_000018619.1.38349 WP_000018619.1.38512 WP_000018619.1.38622 WP_000018619.1.38797 WP_000018619.1.38830 WP_000018619.1.38995 WP_000018619.1.39128 WP_000018619.1.39275 WP_000018619.1.39503 WP_000018619.1.39808 WP_000018619.1.40025 WP_000018619.1.40205 WP_000018619.1.40583 WP_000018619.1.40722 WP_000018619.1.40910 WP_000018619.1.4109 WP_000018619.1.41265 WP_000018619.1.41308 WP_000018619.1.41593 WP_000018619.1.41628 WP_000018619.1.4184 WP_000018619.1.41862 WP_000018619.1.41904 WP_000018619.1.41931 WP_000018619.1.41994 WP_000018619.1.42109 WP_000018619.1.42244 WP_000018619.1.42433 WP_000018619.1.42453 WP_000018619.1.4257 WP_000018619.1.42655 WP_000018619.1.42794 WP_000018619.1.43258 WP_000018619.1.4332 WP_000018619.1.43520 WP_000018619.1.43676 WP_000018619.1.43828 WP_000018619.1.43839 WP_000018619.1.43954 WP_000018619.1.44359 WP_000018619.1.44453 WP_000018619.1.44636 WP_000018619.1.44998 WP_000018619.1.45123 WP_000018619.1.45134 WP_000018619.1.45229 WP_000018619.1.45522 WP_000018619.1.46358 WP_000018619.1.46620 WP_000018619.1.46637 WP_000018619.1.46804 WP_000018619.1.47460 WP_000018619.1.47614 WP_000018619.1.47767 WP_000018619.1.48215 WP_000018619.1.48751 WP_000018619.1.48918 WP_000018619.1.48931 WP_000018619.1.49214 WP_000018619.1.49375 WP_000018619.1.49778 WP_000018619.1.49780 WP_000018619.1.49827 WP_000018619.1.50 WP_000018619.1.50480 WP_000018619.1.50918 WP_000018619.1.51036 WP_000018619.1.5114 WP_000018619.1.5125 WP_000018619.1.51506 WP_000018619.1.51704 WP_000018619.1.51910 WP_000018619.1.52858 WP_000018619.1.52924 WP_000018619.1.53203 WP_000018619.1.53315 WP_000018619.1.53316 WP_000018619.1.53814 WP_000018619.1.5392 WP_000018619.1.5415 WP_000018619.1.55166 WP_000018619.1.55224 WP_000018619.1.55672 WP_000018619.1.55680 WP_000018619.1.55803 WP_000018619.1.56004 WP_000018619.1.56385 WP_000018619.1.57076 WP_000018619.1.57344 WP_000018619.1.57494 WP_000018619.1.57709 WP_000018619.1.57778 WP_000018619.1.57857 WP_000018619.1.58131 WP_000018619.1.58153 WP_000018619.1.58239 WP_000018619.1.58416 WP_000018619.1.5846 WP_000018619.1.58633 WP_000018619.1.59006 WP_000018619.1.5929 WP_000018619.1.59295 WP_000018619.1.59412 WP_000018619.1.59486 WP_000018619.1.59587 WP_000018619.1.59755 WP_000018619.1.59979 WP_000018619.1.60503 WP_000018619.1.60622 WP_000018619.1.60760 WP_000018619.1.60851 WP_000018619.1.60857 WP_000018619.1.6086 WP_000018619.1.60863 WP_000018619.1.60976 WP_000018619.1.61582 WP_000018619.1.61732 WP_000018619.1.61743 WP_000018619.1.6190 WP_000018619.1.61968 WP_000018619.1.62120 WP_000018619.1.62122 WP_000018619.1.62142 WP_000018619.1.62144 WP_000018619.1.62522 WP_000018619.1.62693 WP_000018619.1.62976 WP_000018619.1.63455 WP_000018619.1.6357 WP_000018619.1.63690 WP_000018619.1.63860 WP_000018619.1.63866 WP_000018619.1.63912 WP_000018619.1.63958 WP_000018619.1.63977 WP_000018619.1.64294 WP_000018619.1.64389 WP_000018619.1.6451 WP_000018619.1.64771 WP_000018619.1.65185 WP_000018619.1.65348 WP_000018619.1.65437 WP_000018619.1.65538 WP_000018619.1.65687 WP_000018619.1.65876 WP_000018619.1.66250 WP_000018619.1.66368 WP_000018619.1.66702 WP_000018619.1.66825 WP_000018619.1.67405 WP_000018619.1.67617 WP_000018619.1.67633 WP_000018619.1.67637 WP_000018619.1.67707 WP_000018619.1.67814 WP_000018619.1.6785 WP_000018619.1.67969 WP_000018619.1.68816 WP_000018619.1.6883 WP_000018619.1.6905 WP_000018619.1.69554 WP_000018619.1.69696 WP_000018619.1.69710 WP_000018619.1.69760 WP_000018619.1.69790 WP_000018619.1.69817 WP_000018619.1.70003 WP_000018619.1.70047 WP_000018619.1.70169 WP_000018619.1.70327 WP_000018619.1.70491 WP_000018619.1.70685 WP_000018619.1.70733 WP_000018619.1.70761 WP_000018619.1.70792 WP_000018619.1.70797 WP_000018619.1.70899 WP_000018619.1.71150 WP_000018619.1.71268 WP_000018619.1.714 WP_000018619.1.71407 WP_000018619.1.71452 WP_000018619.1.71923 WP_000018619.1.72243 WP_000018619.1.72277 WP_000018619.1.72281 WP_000018619.1.72283 WP_000018619.1.72307 WP_000018619.1.7243 WP_000018619.1.72793 WP_000018619.1.72894 WP_000018619.1.72944 WP_000018619.1.73164 WP_000018619.1.73328 WP_000018619.1.7374 WP_000018619.1.7394 WP_000018619.1.74028 WP_000018619.1.74089 WP_000018619.1.74454 WP_000018619.1.74946 WP_000018619.1.75058 WP_000018619.1.75301 WP_000018619.1.75740 WP_000018619.1.76 WP_000018619.1.76164 WP_000018619.1.7657 WP_000018619.1.7672 WP_000018619.1.76799 WP_000018619.1.7684 WP_000018619.1.77033 WP_000018619.1.77241 WP_000018619.1.77431 WP_000018619.1.77440 WP_000018619.1.77555 WP_000018619.1.77629 WP_000018619.1.77761 WP_000018619.1.7814 WP_000018619.1.78259 WP_000018619.1.78881 WP_000018619.1.78951 WP_000018619.1.79081 WP_000018619.1.79189 WP_000018619.1.7972 WP_000018619.1.79778 WP_000018619.1.79945 WP_000018619.1.79974 WP_000018619.1.80441 WP_000018619.1.80473 WP_000018619.1.80638 WP_000018619.1.80819 WP_000018619.1.80927 WP_000018619.1.80959 WP_000018619.1.81067 WP_000018619.1.81231 WP_000018619.1.81409 WP_000018619.1.81548 WP_000018619.1.8168 WP_000018619.1.81736 WP_000018619.1.81746 WP_000018619.1.82258 WP_000018619.1.82352 WP_000018619.1.8236 WP_000018619.1.82369 WP_000018619.1.82636 WP_000018619.1.82637 WP_000018619.1.82886 WP_000018619.1.82899 WP_000018619.1.83221 WP_000018619.1.83247 WP_000018619.1.83252 WP_000018619.1.83258 WP_000018619.1.83388 WP_000018619.1.83510 WP_000018619.1.84209 WP_000018619.1.84229 WP_000018619.1.84721 WP_000018619.1.850 WP_000018619.1.85031 WP_000018619.1.85094 WP_000018619.1.85192 WP_000018619.1.85217 WP_000018619.1.85408 WP_000018619.1.85433 WP_000018619.1.85797 WP_000018619.1.86259 WP_000018619.1.86284 WP_000018619.1.86656 WP_000018619.1.86699 WP_000018619.1.86744 WP_000018619.1.86902 WP_000018619.1.8691 WP_000018619.1.86921 WP_000018619.1.87219 WP_000018619.1.87282 WP_000018619.1.87584 WP_000018619.1.8767 WP_000018619.1.87813 WP_000018619.1.88136 WP_000018619.1.88214 WP_000018619.1.88597 WP_000018619.1.88609 WP_000018619.1.88620 WP_000018619.1.88675 WP_000018619.1.88683 WP_000018619.1.88970 WP_000018619.1.89174 WP_000018619.1.89354 WP_000018619.1.89647 WP_000018619.1.89777 WP_000018619.1.89940 WP_000018619.1.90566 WP_000018619.1.90620 WP_000018619.1.90792 WP_000018619.1.90876 WP_000018619.1.91023 WP_000018619.1.91473 WP_000018619.1.91864 WP_000018619.1.92099 WP_000018619.1.92149 WP_000018619.1.92270 WP_000018619.1.92394 WP_000018619.1.92827 WP_000018619.1.93604 WP_000018619.1.93837 WP_000018619.1.94056 WP_000018619.1.94070 WP_000018619.1.94383 WP_000018619.1.94717 WP_000018619.1.94849 WP_000018619.1.94971 WP_000018619.1.9503 WP_000018619.1.95094 WP_000018619.1.95235 WP_000018619.1.95623 WP_000018619.1.95729 WP_000018619.1.95805 WP_000018619.1.96042 WP_000018619.1.96640 WP_000018619.1.96642 WP_000018619.1.97628 WP_000018619.1.97693 WP_000018619.1.97768 WP_000018619.1.9863 WP_000018619.1.98763 WP_000018619.1.9887 WP_000018619.1.99071 WP_000018619.1.99107 WP_000018619.1.99219 WP_000018619.1.99255 WP_000018619.1.99278 WP_000018619.1.99327 WP_000018619.1.99637 454166.SeAg_B3505 ABAK02000001|CDS_2799287-2800273 ABEI01000008|CDS_202190-203176 CP001138|CDS_3398173-3399159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]