SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197250216|ref|YP_002148528.1| from Salmonella enterica subsp. enterica serovar Agona str. SL483

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197250216|ref|YP_002148528.1|
Domain Number 1 Region: 6-324
Classification Level Classification E-value
Superfamily SIS domain 1.21e-59
Family double-SIS domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197250216|ref|YP_002148528.1|
Sequence length 324
Comment sugar isomerase [Salmonella enterica subsp. enterica serovar Agona str. SL483]
Sequence
MGMKETVSNIVTSQAEKGGVKHVYYVACGGSYAAFYPAKAFLEKEAKALTVGLYNSGEFI
NNPPVALGENAVVVVASHKGNTPETIKAAEIARQHGAPVIGLTWIMDSPLVAHCDYVETY
TFGDGKDIAGEKTMKGLLSAVELLQQTEGYAHYDDFQDGVSKINRIVWRACEQVAERAQA
FAQEYKDDKVIYTVASGAGYGAAYLQSICIFMEMQWIHSACIHSGEFFHGPFEITDANTP
FFFQFSEGNTRAVDERALNFLKKYGRRIEVVDAKELGLSTIKTTVIDYFNHSLFNNVYPV
YNRALAEARQHPLTTRRYMWKVEY
Download sequence
Identical sequences A0A0H3TK00 A0A0M0PQZ9 A0A0N1TUP4 A0A1U7FID9 A0A2C6GF11 A0A2D3AHK2 A0A2D3TRA4 A0A2I6M2R2 A0A2I6NYV1 B5F9G7 G5PU57 S5I0J7
gi|197250216|ref|YP_002148528.1| gi|386593272|ref|YP_006089672.1| gi|549480909|ref|YP_008615236.1| gi|161616653|ref|YP_001590618.1| 272994.SPAB_04470 439843.SeSA_A3795 454166.SeAg_B3807 454169.SeHA_C3915 ABAK02000001|CDS_3090964-3089990 ABAM02000001|CDS_4146805-4145831 ABAN01000001|CDS_289696-290670 ABAO01000004|CDS_132081-131107 ABEH02000004|CDS_316573-317547 ABEI01000011|CDS_13242-12268 ABEJ01000002|CDS_161128-160154 ABEL01000003|CDS_170858-169884 ABEW01000004|CDS_316024-316998 CP000886|CDS_3725695-3724721 CP001120|CDS_3787468-3786494 CP001127|CDS_3658323-3657349 CP001138|CDS_3691618-3690644 NZ_ACBF01000002|CDS_257635-258609 gi|452122599|ref|YP_007472847.1| gi|525945753|ref|YP_008306743.1| gi|525840287|ref|YP_008257784.1| gi|482906165|ref|YP_007904725.1| gi|194450740|ref|YP_002047628.1| gi|525814870|ref|YP_008244888.1| gi|526218480|ref|YP_008263653.1| gi|525828667|ref|YP_008251588.1| gi|194734834|ref|YP_002116538.1| gi|563654937|ref|YP_008863027.1| gi|525859273|ref|YP_008262845.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]