SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197250277|ref|YP_002149236.1| from Salmonella enterica subsp. enterica serovar Agona str. SL483

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197250277|ref|YP_002149236.1|
Domain Number 1 Region: 10-186
Classification Level Classification E-value
Superfamily SIS domain 5.56e-28
Family mono-SIS domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197250277|ref|YP_002149236.1|
Sequence length 187
Comment 3-hexulose-6-phosphate isomerase [Salmonella enterica subsp. enterica serovar Agona str. SL483]
Sequence
MATKNYRENVGIIEKELSMVLSRIDERQIDEYISTLLQAEKVFFVGVGRVLLALEMTVKR
LNHLGINACVVGAVNEPPIGPKDILVVGSGSGESIFPKHITACAKRYDAKIVHLTSSPTS
SIAQLADVIVDFHCGSKGGTGEYISIQPMTTLFEQSLVLFGDLVCLEIMAIKQLSLANVK
LNHANLE
Download sequence
Identical sequences A0A1X2V955 A0A267SNQ9 B5F2J7 G5PW65 G5R905
CP001138|CDS_4493388-4493951 454166.SeAg_B4594 gi|563655608|ref|YP_008863711.1| gi|197250277|ref|YP_002149236.1| WP_000201885.1.10013 WP_000201885.1.1002 WP_000201885.1.100721 WP_000201885.1.100790 WP_000201885.1.100932 WP_000201885.1.101094 WP_000201885.1.101473 WP_000201885.1.101639 WP_000201885.1.10507 WP_000201885.1.10797 WP_000201885.1.11213 WP_000201885.1.11369 WP_000201885.1.11621 WP_000201885.1.11938 WP_000201885.1.12059 WP_000201885.1.12063 WP_000201885.1.12396 WP_000201885.1.12650 WP_000201885.1.13829 WP_000201885.1.14528 WP_000201885.1.15479 WP_000201885.1.1551 WP_000201885.1.15978 WP_000201885.1.16052 WP_000201885.1.16158 WP_000201885.1.16656 WP_000201885.1.16826 WP_000201885.1.16855 WP_000201885.1.16942 WP_000201885.1.17949 WP_000201885.1.18426 WP_000201885.1.18445 WP_000201885.1.18485 WP_000201885.1.18919 WP_000201885.1.19038 WP_000201885.1.1939 WP_000201885.1.19469 WP_000201885.1.19683 WP_000201885.1.20081 WP_000201885.1.20795 WP_000201885.1.22623 WP_000201885.1.23080 WP_000201885.1.23258 WP_000201885.1.23274 WP_000201885.1.23529 WP_000201885.1.23675 WP_000201885.1.24696 WP_000201885.1.24837 WP_000201885.1.25205 WP_000201885.1.25514 WP_000201885.1.26512 WP_000201885.1.26883 WP_000201885.1.272 WP_000201885.1.2723 WP_000201885.1.28002 WP_000201885.1.28776 WP_000201885.1.28811 WP_000201885.1.28977 WP_000201885.1.29732 WP_000201885.1.30018 WP_000201885.1.30331 WP_000201885.1.30696 WP_000201885.1.30803 WP_000201885.1.31155 WP_000201885.1.3278 WP_000201885.1.33870 WP_000201885.1.34084 WP_000201885.1.34659 WP_000201885.1.34704 WP_000201885.1.34881 WP_000201885.1.3541 WP_000201885.1.35835 WP_000201885.1.35868 WP_000201885.1.36229 WP_000201885.1.36885 WP_000201885.1.37021 WP_000201885.1.37147 WP_000201885.1.37158 WP_000201885.1.3728 WP_000201885.1.38055 WP_000201885.1.38113 WP_000201885.1.3828 WP_000201885.1.40492 WP_000201885.1.40910 WP_000201885.1.4109 WP_000201885.1.41265 WP_000201885.1.41308 WP_000201885.1.41593 WP_000201885.1.41628 WP_000201885.1.4184 WP_000201885.1.41938 WP_000201885.1.42453 WP_000201885.1.43070 WP_000201885.1.43676 WP_000201885.1.43828 WP_000201885.1.44132 WP_000201885.1.44191 WP_000201885.1.44359 WP_000201885.1.44453 WP_000201885.1.44636 WP_000201885.1.45134 WP_000201885.1.45462 WP_000201885.1.46299 WP_000201885.1.46358 WP_000201885.1.46637 WP_000201885.1.47442 WP_000201885.1.47460 WP_000201885.1.47614 WP_000201885.1.47767 WP_000201885.1.48124 WP_000201885.1.48751 WP_000201885.1.48774 WP_000201885.1.49214 WP_000201885.1.49574 WP_000201885.1.49848 WP_000201885.1.50198 WP_000201885.1.50769 WP_000201885.1.50811 WP_000201885.1.51036 WP_000201885.1.5114 WP_000201885.1.5125 WP_000201885.1.51704 WP_000201885.1.51910 WP_000201885.1.52527 WP_000201885.1.52608 WP_000201885.1.53016 WP_000201885.1.53100 WP_000201885.1.53315 WP_000201885.1.53814 WP_000201885.1.5392 WP_000201885.1.5415 WP_000201885.1.54159 WP_000201885.1.54558 WP_000201885.1.55166 WP_000201885.1.55803 WP_000201885.1.56004 WP_000201885.1.56354 WP_000201885.1.57076 WP_000201885.1.57344 WP_000201885.1.57521 WP_000201885.1.58131 WP_000201885.1.58239 WP_000201885.1.59006 WP_000201885.1.59148 WP_000201885.1.5929 WP_000201885.1.59648 WP_000201885.1.5993 WP_000201885.1.59979 WP_000201885.1.60330 WP_000201885.1.60503 WP_000201885.1.60622 WP_000201885.1.60760 WP_000201885.1.60863 WP_000201885.1.60990 WP_000201885.1.61184 WP_000201885.1.61732 WP_000201885.1.62144 WP_000201885.1.62344 WP_000201885.1.62361 WP_000201885.1.62693 WP_000201885.1.62725 WP_000201885.1.63499 WP_000201885.1.6367 WP_000201885.1.63690 WP_000201885.1.63860 WP_000201885.1.63864 WP_000201885.1.63866 WP_000201885.1.63912 WP_000201885.1.63958 WP_000201885.1.6451 WP_000201885.1.64798 WP_000201885.1.6561 WP_000201885.1.65849 WP_000201885.1.66779 WP_000201885.1.67772 WP_000201885.1.67814 WP_000201885.1.6785 WP_000201885.1.67969 WP_000201885.1.6879 WP_000201885.1.69554 WP_000201885.1.70003 WP_000201885.1.70169 WP_000201885.1.70327 WP_000201885.1.70733 WP_000201885.1.70761 WP_000201885.1.70899 WP_000201885.1.7134 WP_000201885.1.714 WP_000201885.1.7142 WP_000201885.1.71500 WP_000201885.1.71746 WP_000201885.1.71941 WP_000201885.1.72243 WP_000201885.1.72793 WP_000201885.1.72843 WP_000201885.1.74040 WP_000201885.1.74089 WP_000201885.1.74454 WP_000201885.1.7458 WP_000201885.1.74806 WP_000201885.1.75301 WP_000201885.1.75740 WP_000201885.1.76156 WP_000201885.1.76197 WP_000201885.1.76799 WP_000201885.1.7684 WP_000201885.1.77241 WP_000201885.1.77596 WP_000201885.1.7814 WP_000201885.1.78771 WP_000201885.1.78881 WP_000201885.1.78913 WP_000201885.1.79011 WP_000201885.1.79934 WP_000201885.1.79974 WP_000201885.1.80307 WP_000201885.1.80473 WP_000201885.1.81727 WP_000201885.1.81736 WP_000201885.1.83258 WP_000201885.1.84209 WP_000201885.1.84551 WP_000201885.1.84745 WP_000201885.1.85217 WP_000201885.1.85408 WP_000201885.1.85784 WP_000201885.1.86284 WP_000201885.1.86656 WP_000201885.1.8691 WP_000201885.1.87282 WP_000201885.1.88214 WP_000201885.1.88683 WP_000201885.1.88970 WP_000201885.1.90220 WP_000201885.1.91334 WP_000201885.1.91453 WP_000201885.1.91579 WP_000201885.1.91864 WP_000201885.1.92099 WP_000201885.1.92394 WP_000201885.1.92827 WP_000201885.1.94167 WP_000201885.1.94717 WP_000201885.1.94722 WP_000201885.1.94862 WP_000201885.1.95623 WP_000201885.1.95729 WP_000201885.1.9574 WP_000201885.1.96042 WP_000201885.1.96141 WP_000201885.1.96190 WP_000201885.1.96642 WP_000201885.1.96761 WP_000201885.1.97368 WP_000201885.1.98201 WP_000201885.1.9863 WP_000201885.1.98931 WP_000201885.1.99278 WP_000201885.1.99370 WP_000201885.1.99469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]