SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197250316|ref|YP_002147113.1| from Salmonella enterica subsp. enterica serovar Agona str. SL483

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197250316|ref|YP_002147113.1|
Domain Number 1 Region: 4-325
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.44e-67
Family ADP-ribosylglycohydrolase 0.0000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|197250316|ref|YP_002147113.1|
Sequence length 334
Comment ADP-ribosylglycohydrolase family protein [Salmonella enterica subsp. enterica serovar Agona str. SL483]
Sequence
MKAERILGALYGQALGDAMGMPSELWPRTRVKAHFGWIDRFLPGPKENNAACYFNRAEFT
DDTAMALCLADALLECEGSIDPEIIGRNILAWAERFDAFNKNVLGPTSKIALNAIRDGKP
IAALENNGVTNGAAMRVSPLGCLLPPTNLTAFIAEVALASSPTHKSDLAVAGAVVVAWAV
SRAVNGDTWQSIADSLPAVAHQAQTARITTFSASLSARLELALNIVRHADGVESASEQLY
QIIGAGTSTIESVPCAIAMVELANTDPNRCAVLCANLGGDTDTIGAMATAICGALHGVSA
INPQLKQTLDEVNQLDFARYAVALASYRQRREAL
Download sequence
Identical sequences B5EXY2 G4C0L0
WP_000642799.1.100007 WP_000642799.1.10013 WP_000642799.1.100721 WP_000642799.1.100790 WP_000642799.1.100932 WP_000642799.1.101199 WP_000642799.1.10276 WP_000642799.1.10507 WP_000642799.1.10797 WP_000642799.1.11369 WP_000642799.1.11621 WP_000642799.1.12047 WP_000642799.1.12059 WP_000642799.1.12650 WP_000642799.1.12864 WP_000642799.1.13543 WP_000642799.1.13829 WP_000642799.1.13848 WP_000642799.1.14528 WP_000642799.1.14884 WP_000642799.1.15479 WP_000642799.1.15978 WP_000642799.1.16052 WP_000642799.1.1611 WP_000642799.1.16158 WP_000642799.1.16656 WP_000642799.1.16826 WP_000642799.1.16998 WP_000642799.1.17504 WP_000642799.1.17949 WP_000642799.1.18177 WP_000642799.1.18426 WP_000642799.1.18445 WP_000642799.1.18919 WP_000642799.1.19469 WP_000642799.1.20023 WP_000642799.1.20081 WP_000642799.1.20218 WP_000642799.1.20795 WP_000642799.1.2091 WP_000642799.1.21940 WP_000642799.1.22623 WP_000642799.1.23080 WP_000642799.1.23258 WP_000642799.1.23279 WP_000642799.1.23639 WP_000642799.1.23675 WP_000642799.1.24837 WP_000642799.1.25205 WP_000642799.1.25514 WP_000642799.1.25825 WP_000642799.1.26034 WP_000642799.1.26787 WP_000642799.1.26883 WP_000642799.1.27051 WP_000642799.1.272 WP_000642799.1.2723 WP_000642799.1.27798 WP_000642799.1.28002 WP_000642799.1.28811 WP_000642799.1.28977 WP_000642799.1.29732 WP_000642799.1.30331 WP_000642799.1.30696 WP_000642799.1.30819 WP_000642799.1.30951 WP_000642799.1.31001 WP_000642799.1.31086 WP_000642799.1.31155 WP_000642799.1.31156 WP_000642799.1.3170 WP_000642799.1.32006 WP_000642799.1.32624 WP_000642799.1.3278 WP_000642799.1.33010 WP_000642799.1.33486 WP_000642799.1.34081 WP_000642799.1.34084 WP_000642799.1.34304 WP_000642799.1.34881 WP_000642799.1.35835 WP_000642799.1.36229 WP_000642799.1.36286 WP_000642799.1.36885 WP_000642799.1.37021 WP_000642799.1.37147 WP_000642799.1.37158 WP_000642799.1.37267 WP_000642799.1.3728 WP_000642799.1.38055 WP_000642799.1.38113 WP_000642799.1.3828 WP_000642799.1.38995 WP_000642799.1.40910 WP_000642799.1.4109 WP_000642799.1.41265 WP_000642799.1.41299 WP_000642799.1.41308 WP_000642799.1.41628 WP_000642799.1.4184 WP_000642799.1.42453 WP_000642799.1.42981 WP_000642799.1.43676 WP_000642799.1.43828 WP_000642799.1.44191 WP_000642799.1.44453 WP_000642799.1.44636 WP_000642799.1.45134 WP_000642799.1.45322 WP_000642799.1.46358 WP_000642799.1.46637 WP_000642799.1.47460 WP_000642799.1.47614 WP_000642799.1.47767 WP_000642799.1.48218 WP_000642799.1.48247 WP_000642799.1.48751 WP_000642799.1.49005 WP_000642799.1.49214 WP_000642799.1.49262 WP_000642799.1.49602 WP_000642799.1.50386 WP_000642799.1.50478 WP_000642799.1.50565 WP_000642799.1.5058 WP_000642799.1.51036 WP_000642799.1.5125 WP_000642799.1.51419 WP_000642799.1.51704 WP_000642799.1.51910 WP_000642799.1.51914 WP_000642799.1.53315 WP_000642799.1.53814 WP_000642799.1.5392 WP_000642799.1.5415 WP_000642799.1.54984 WP_000642799.1.55166 WP_000642799.1.55461 WP_000642799.1.56354 WP_000642799.1.57076 WP_000642799.1.57344 WP_000642799.1.57399 WP_000642799.1.57521 WP_000642799.1.5781 WP_000642799.1.58239 WP_000642799.1.58251 WP_000642799.1.58451 WP_000642799.1.58729 WP_000642799.1.59006 WP_000642799.1.5929 WP_000642799.1.59709 WP_000642799.1.59979 WP_000642799.1.60231 WP_000642799.1.60503 WP_000642799.1.60622 WP_000642799.1.60863 WP_000642799.1.61114 WP_000642799.1.62144 WP_000642799.1.62693 WP_000642799.1.63499 WP_000642799.1.63690 WP_000642799.1.63860 WP_000642799.1.63912 WP_000642799.1.63958 WP_000642799.1.6451 WP_000642799.1.65968 WP_000642799.1.6647 WP_000642799.1.66779 WP_000642799.1.67814 WP_000642799.1.67969 WP_000642799.1.68115 WP_000642799.1.68147 WP_000642799.1.685 WP_000642799.1.69554 WP_000642799.1.69597 WP_000642799.1.69982 WP_000642799.1.70003 WP_000642799.1.70169 WP_000642799.1.70327 WP_000642799.1.70761 WP_000642799.1.70899 WP_000642799.1.714 WP_000642799.1.72243 WP_000642799.1.72307 WP_000642799.1.72793 WP_000642799.1.73512 WP_000642799.1.74089 WP_000642799.1.74454 WP_000642799.1.74807 WP_000642799.1.75301 WP_000642799.1.75664 WP_000642799.1.76186 WP_000642799.1.7629 WP_000642799.1.7633 WP_000642799.1.76799 WP_000642799.1.7684 WP_000642799.1.77241 WP_000642799.1.7814 WP_000642799.1.78715 WP_000642799.1.78881 WP_000642799.1.79929 WP_000642799.1.79942 WP_000642799.1.80473 WP_000642799.1.80480 WP_000642799.1.81736 WP_000642799.1.81743 WP_000642799.1.82530 WP_000642799.1.82886 WP_000642799.1.83258 WP_000642799.1.83360 WP_000642799.1.84209 WP_000642799.1.84551 WP_000642799.1.8591 WP_000642799.1.86120 WP_000642799.1.86284 WP_000642799.1.86656 WP_000642799.1.8691 WP_000642799.1.87282 WP_000642799.1.88214 WP_000642799.1.88264 WP_000642799.1.88683 WP_000642799.1.88970 WP_000642799.1.89580 WP_000642799.1.91042 WP_000642799.1.91864 WP_000642799.1.92099 WP_000642799.1.92394 WP_000642799.1.92399 WP_000642799.1.92659 WP_000642799.1.92827 WP_000642799.1.94717 WP_000642799.1.94987 WP_000642799.1.95623 WP_000642799.1.95729 WP_000642799.1.96042 WP_000642799.1.96045 WP_000642799.1.96533 WP_000642799.1.96642 WP_000642799.1.96761 WP_000642799.1.9811 WP_000642799.1.98438 WP_000642799.1.98483 WP_000642799.1.9863 WP_000642799.1.99278 gi|197250316|ref|YP_002147113.1| 454166.SeAg_B2286 CP001138|CDS_2203129-2204133 gi|563653623|ref|YP_008861697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]