SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217972290|ref|YP_002357041.1| from Shewanella baltica OS223

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217972290|ref|YP_002357041.1|
Domain Number 1 Region: 53-190
Classification Level Classification E-value
Superfamily CBS-domain pair 4.55e-34
Family CBS-domain pair 0.0029
Further Details:      
 
Domain Number 2 Region: 203-289
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.73e-23
Family CorC/HlyC domain-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|217972290|ref|YP_002357041.1|
Sequence length 291
Comment hypothetical protein Sbal223_1103 [Shewanella baltica OS223]
Sequence
MSDDIPPSTNAHKKGWFDRVSQLFQGEPQNREDLVDVIDGAEQRDLITQDTREMIKGVLD
VSDMRVRDIMIPRAQIVALQIDNSVEELLATVIGSGHSRFPVVNEDKDHIEGILLAKDLI
PYGFSNSDEPFSLDRVIRPAVVVPESKRVDVLLKEFRSQRYHMAIVVDEYGGVSGLVTIE
DILEEIVGEIEDEFDHDSTEETEIRKVGNTVYMVKALTPIEDFNEEFNTEFSDEEFDTVG
GLVSHAFGHLPERNESIIIEGIEFKVINADTRRLIQLRVKLPDPNTGEDVE
Download sequence
Identical sequences A0A165JYD6 A3D7N1 A9KZZ6 B8E6K7 G0B0H5
gi|126175464|ref|YP_001051613.1| 325240.Sbal_3264 399599.Sbal195_3442 402882.Shew185_3306 407976.Sbal223_1103 gi|217972290|ref|YP_002357041.1| gi|386323567|ref|YP_006019684.1| gi|378709753|ref|YP_005274647.1| gi|160876548|ref|YP_001555864.1| gi|386342208|ref|YP_006038574.1| WP_006082742.1.19221 WP_006082742.1.24904 WP_006082742.1.35668 WP_006082742.1.35710 WP_006082742.1.60405 WP_006082742.1.74325 WP_006082742.1.76213 WP_006082742.1.76739 WP_006082742.1.8014 WP_006082742.1.85636 WP_006082742.1.86146 WP_006082742.1.93117 gi|153001815|ref|YP_001367496.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]