SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|217973934|ref|YP_002358685.1| from Shewanella baltica OS223

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|217973934|ref|YP_002358685.1|
Domain Number 1 Region: 58-530
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.61e-109
Family Pyridoxal-dependent decarboxylase 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|217973934|ref|YP_002358685.1|
Sequence length 549
Comment pyridoxal-dependent decarboxylase [Shewanella baltica OS223]
Sequence
MTQKLPRQATASEESLLRIFTAPEDAGSTLSIIEQKLSEDLAGFLGDSIAALEKPLSEIE
TDFQAFEIPTQPRFVSDYTDEIMQNLVAHSVHTAAPSFIGHMTSALPYFVLPLSKMMVGL
NQNLVKIETSKAFTPLERQVLGMMHHLIYDQDTDFYQSWMHSANHSLGAFCSGGTVANIT
ALWIARNQLLKADGEFKGVSREGLLKALRHYGYDDLAILVSERGHYSLGKAVDLLGIGRD
NIISIPTGSDNKVDVAKMRQAALELARKNIKVLAIVGVAGTTETGNVDPLAELAALAKEL
NCHFHVDAAWGGASLLSNKYRHLLAGIELADSVTIDAHKQMYVPMGAGMVLFKDPEFAHA
IAHHAEYILRRGSKDLGSQTLEGSRPGMAMLVHACLQIIGRDGYEILINNSLEKARYFAE
QIKAHEDFELVTEPELCLLTYRYVPARVQAAMKLACEQADTIRVARFNELLDGLTQFIQK
HQREQGKSFVSRTRIQPARYFRQATVVFRVVLANPLTSHDILNQVLVEQSEIAALDNEFL
PALMAMVAQ
Download sequence
Identical sequences B8E5H3
WP_012588048.1.74325 407976.Sbal223_2774 gi|217973934|ref|YP_002358685.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]