SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197123092|ref|YP_002135043.1| from Anaeromyxobacter sp. K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197123092|ref|YP_002135043.1|
Domain Number 1 Region: 8-136
Classification Level Classification E-value
Superfamily Nudix 1.3e-25
Family MutT-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197123092|ref|YP_002135043.1|
Sequence length 141
Comment NUDIX hydrolase [Anaeromyxobacter sp. K]
Sequence
MSERRAFSTSVFCRHGGAVLLIRHRRLGTWLPVGGELEPGETPLEGAVRELREETGLTGR
FPAGLGVDGSPPGFIGYEEHPAGSKGLHLNFAFVADVAGRDLAACDEWDAARWVTRGELA
ALECPANVRQLAALALDAPGA
Download sequence
Identical sequences B4UHP4
WP_012526694.1.49349 gi|197123092|ref|YP_002135043.1| 447217.AnaeK_2689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]