SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|317051166|ref|YP_004112282.1| from Desulfurispirillum indicum S5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317051166|ref|YP_004112282.1|
Domain Number 1 Region: 8-192
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 6.02e-56
Family Methylesterase CheB, C-terminal domain 0.0000967
Further Details:      
 
Domain Number 2 Region: 274-460
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.08e-43
Family Chemotaxis receptor methyltransferase CheR, C-terminal domain 0.00034
Further Details:      
 
Domain Number 3 Region: 1105-1281
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.56e-30
Family Histidine kinase 0.03
Further Details:      
 
Domain Number 4 Region: 859-1011
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.16e-21
Family Heme-binding PAS domain 0.044
Further Details:      
 
Domain Number 5 Region: 203-275
Classification Level Classification E-value
Superfamily Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.00000000000902
Family Chemotaxis receptor methyltransferase CheR, N-terminal domain 0.0056
Further Details:      
 
Domain Number 6 Region: 753-871
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000126
Family Heme-binding PAS domain 0.029
Further Details:      
 
Domain Number 7 Region: 1029-1100
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000569
Family Homodimeric domain of signal transducing histidine kinase 0.0064
Further Details:      
 
Weak hits

Sequence:  gi|317051166|ref|YP_004112282.1|
Domain Number - Region: 645-709
Classification Level Classification E-value
Superfamily Tropomyosin 0.00458
Family Tropomyosin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|317051166|ref|YP_004112282.1|
Sequence length 1281
Comment PAS sensor protein [Desulfurispirillum indicum S5]
Sequence
MEQPAKGIYIVGIGASAGGLEALRALTSHLPADGDIAYIIAQHLSPSHRSMLVSLLAKEC
LLPVLEAVDGAAVEAGHIYITPPNYDITLTADEKIRLRQPAQPMGPKPSVDTLLCSLAEV
KKEKAIAIILSGTGSDGSVGVRAIKAEGGIVIAQEPSTAKYDSMPNAAISTTHVDLVLPP
ERIGQEVPEIFRFPEKFLVEKQIKKAPGNIDRIFRILTERGEVDFSGYKLTTLNRRIERR
MAATRVTNLGDYVSLLEESADEWKLLFKDILISVTAFFRDRESFNSLEKALESLVANKRN
GDSIRVWVPGCATGEEAYTLAVMLWEIVHRMGKKCHMQIFATDIDTDALMHARKGLYSQA
LLEGMEPALLEKYFTRKGSSFEVAKFLREMIVFSRHNLIKDPPFLRIDLISCRNLLIYFT
QPLQKKVFSLFHYSLAPKGILFLGKSESIGDNETLFASFHDKAKIYERKGGVKSPIVSGN
GNYALLRRSATPAPKPAKEYRLEDALAQTCLKLFSKCSIVVDCEYSIIHVRGDASNFLTL
PSGDFSGNALKMLPRELGIDLRAAVGRLSSGDVPLFRGNLHKIQTGSTWSYVRILASRVE
HEGEAVGYFLIVLEEEDNAFALQHCPVESVSEDGHVQIQELQHELISSKEHLQTVIEELE
TSNEELQSLNEELQSANEELQSSNEELETTNEELQSTNEELSSAYAELKVVYDEKESQRL
ELVNKTHELQESQQVLEVRQNFITGIMQTSPVGILRIDRDRKIDFINAYAEKLLGFAEHS
LLGNSYHVVESLLKSLDAKKLTAEQKPLACALKNKRTLHNLEYAVSALTDVARTLSISIT
PNFSPGGIFESAVLALVDITEKKRIERELKQKQTELEFINHNLEKRVNEEVQRRMNRETL
INAIYDEANVAIGITDTKARIIHANKAFCTTFGYTYDEIIGQSFLVLVPPNRQQAYRQKH
RSLMESQDQDRAVERVMRHRNGATLEVLVSRKAIITEDSTPALLSIITDITSMKRIQREK
EQQEKILIQQTKMAAMGEMVSAIAHQWRQPLNVVGMLVQDIRDSYRYGMLDQGSLDVKVQ
RTMETIRFMSDTIDDFRNFFIPDKEKERFDVMESLRQVAHMLSSQMRSHNVVLYRQHVRS
GKCVPLLEDKSRSSAPYLVTGYPNEFKQVLFNLLNNSRDAIMQHRLDHDGQPQDGSIHVS
ISRQGRGRLIIRIVDNGGGIDPEVLPRIFEPYFTTKDQTKGSGITGTGIGLYMAKIIVQD
NMGGKISARSIDGGAEFTIEL
Download sequence
Identical sequences E6W365
WP_013505609.1.92402 gi|317051166|ref|YP_004112282.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]