SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307595492|ref|YP_003901809.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307595492|ref|YP_003901809.1|
Domain Number 1 Region: 154-292
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 3.67e-38
Family Multidomain sulfurtransferase (rhodanese) 0.0000162
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 4.98e-35
Family Multidomain sulfurtransferase (rhodanese) 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307595492|ref|YP_003901809.1|
Sequence length 295
Comment rhodanese domain-containing protein [Vulcanisaeta distributa DSM 14429]
Sequence
MGYAHPEVLVDTEWVVNHLKDPKVKIVEVDYDPSTAYFVWHIPGASLLTWKDHIRHPVRR
DFVEPDQFARFMEERGISNDTTVVLYGDYNNWFAAYAFWVFKVYGHEDVRLLNGGRTKWA
KENRPTCSGHQEPHYYREAGAKYVVKRVDWGSHRVYAWEILNRLNKGEVGKSLMLVDVRS
PKEYTGEITAPPEYPNEHAQVGGHIPGAINIPWSLAVNPETGEFKSPDELRRLYEQYGIT
SDKEIVTYCRIAERASHTWFVLKYLLGYPSVRVYDGSWAEWGNMVGVPIKKGQEP
Download sequence
Identical sequences E1QSG5
WP_013336483.1.43420 gi|307595492|ref|YP_003901809.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]