SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307595826|ref|YP_003902143.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307595826|ref|YP_003902143.1|
Domain Number 1 Region: 20-148
Classification Level Classification E-value
Superfamily Globin-like 1.65e-17
Family Globins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307595826|ref|YP_003902143.1|
Sequence length 195
Comment hypothetical protein Vdis_1718 [Vulcanisaeta distributa DSM 14429]
Sequence
MSYFIEGSEISKLLSRIVNTTMNQIPPQARFNDSDISIIMKYRPLLESITGDIVKGFYDT
LFSHGPTAAVFQADERPLREKTLRDWWIRTLRGPFNEDYWLWQTYVGIIHYRRSVTPPMF
MGMWAWIIDNVIKKVQASPELISALVKFGVTQSSLMVGGYYDIMEYALSRVNINGDLLRN
LVISIIEELASGVKK
Download sequence
Identical sequences E1QU98
WP_013336817.1.43420 gi|307595826|ref|YP_003902143.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]