SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307596106|ref|YP_003902423.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307596106|ref|YP_003902423.1|
Domain Number 1 Region: 102-426
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.53e-76
Family Amylase, catalytic domain 0.00000383
Further Details:      
 
Domain Number 2 Region: 14-73
Classification Level Classification E-value
Superfamily E set domains 0.0000000933
Family AMPK-beta glycogen binding domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307596106|ref|YP_003902423.1|
Sequence length 474
Comment alpha amylase [Vulcanisaeta distributa DSM 14429]
Sequence
MPITVFKSGNLYFVRFSVNKQPRRAAFVIGSFTAFMKPIELEFCGPDYCAYISLPPGKYY
YRYLVDGEVVLDDGPTENGFNVLKLGGSIRRVHENRRRLFRAIYGIFVDRFGCKRKGGPR
DRLGGDLSFITDKLSYIRSMGFDAIYLTPIFRAMSYHRYDVVDYINVDDDLGGNNAFKEL
LRRAHELGIKVILDLPIHHTGSEHPAFRAALSGDPKYSHWYYIYNGDYEKFMDVKRMPKL
NMKFAGEWVKGIVLHWALVGVDAFRIDVGAGIPPWFLWDLRNFINKPLIAEVWGDPFLWR
NAVDGVMNYQVWEPLIKFLRDEINAEDFAQVLKRQLNVLPKHFLINSWLFVDTHDTPRAI
TMLNNDIEKFKAALAFIYTWIGTPMLYYGDEVMLEGGPDPDNRRCMDWKRVNGPNTLHEF
VRRLSGLNLMPRRIIVNSSELIYYDNKFEVRLSNRPRRYGSGVLSGDYFIIKGR
Download sequence
Identical sequences E1QP07
gi|307596106|ref|YP_003902423.1| WP_013337097.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]