SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307596316|ref|YP_003902633.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307596316|ref|YP_003902633.1|
Domain Number 1 Region: 1-262
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 3.97e-67
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000232
Further Details:      
 
Domain Number 2 Region: 253-464
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 9.6e-57
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307596316|ref|YP_003902633.1|
Sequence length 469
Comment Vinylacetyl-CoA Delta-isomerase [Vulcanisaeta distributa DSM 14429]
Sequence
MPRSATDYINSVRDGRVVYYRGKRVDDITTHPIISIAVRHAADLFDVKDRLYDDPNYGRI
SRYFKVPKNTNDLLERHKLIYEDTLRFDGLFNIVQAIGSDALFSLMIIARKVDRKYGTNY
YDRVMKYYEYVVKNDLAIAVAQTDVKGNRAKRPHEQEDRDMYLRVVEVRDDGIVVNGAKI
HTTQGPVANEIIVLPYRAMVEGDRDYAVAFAVPANAKGLKFIVRPVLEYDGNPNAVNAAS
RFEVESLTIFDHVFVPWDRVFMFREWDLAGQLAWTFATYHRFTAISYRAATANLYLGAAL
YAARANGIENAPHVRDWLVQMIMYKEIMRMGAMAAALEPWIDEGIAIPNPIYTNVSKLYA
NAHFIDVVHGLIDIAGGLIATMPSHDDYANPEERQYISKYLRGAVDGDTRYKVMSLVREL
GASHLVGYLLTAMIHAEGSEAASKIGMLREYNYKEAEELINKILSKIKL
Download sequence
Identical sequences E1QQ95
WP_013337307.1.43420 gi|307596316|ref|YP_003902633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]