SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307594823|ref|YP_003901140.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307594823|ref|YP_003901140.1|
Domain Number 1 Region: 17-310
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.74e-74
Family PFOR PP module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307594823|ref|YP_003901140.1|
Sequence length 323
Comment thiamine pyrophosphate domain-containing TPP-binding protein [Vulcanisaeta distributa DSM 14429]
Sequence
MVVKVRLAKSLFDIPREEYLAPGHTACPACGATLAARLILKASGPDVIIVNPTGCLEVTT
TIYPYTAWGVPYIHVAFENAGAVASGIEAAIKALNKNGLLRRSTRVIAIAGDGGTFDIGL
QSLSGMLERGHGVLYVLYDNEAYMNTGIQRSGGTPKFAKTTTMPAGTIIRGKIQRKKDIM
SIVIAHHIPYAATANVAYPIDLVNKVRKALSYLDEGPAFIHVLAPCPPGWGFPDERMIEI
ARLATETGYFPLYEWDHDRLIINPPSDMYMDRRLRKPLREFVKAQSRWSHITDEEIKELE
KDVDDFLNYLWRLSMSSGVSILY
Download sequence
Identical sequences E1QNB9
gi|307594823|ref|YP_003901140.1| WP_013335814.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]