SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307595181|ref|YP_003901498.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307595181|ref|YP_003901498.1|
Domain Number 1 Region: 12-285
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.24e-78
Family Pyruvate oxidase and decarboxylase PP module 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307595181|ref|YP_003901498.1|
Sequence length 320
Comment pyruvate ferredoxin/flavodoxin oxidoreductase subunit beta [Vulcanisaeta distributa DSM 14429]
Sequence
MSNTVKITVKRTPMDYVEKRRRPDWCPGCGDYGILQALYQALADLNLDPHSVFLVSGIGC
SAKTIHYVNANGAHTLHGRPIPYATGIKLANPNLEVIVIGGDGDLMGIGAEHLVHAGRRN
VDLTVLMFDNGVYGLTKGQASPTLRRGVKTKALARPNIYDAINPVVLALSVGFTFVARGY
AYDVKHLAYLIKEAIRHKGSAFIDILQPCPTYNDVNTKEWYEARIYKLENEPGWDPVVRS
PSEEEVTKKLTQAFLRGMEWGDKIPIGIFYQNEYVPTYEERIMEQMPNYLKAPPALSPLY
GPDGSTIVNIEDILREKEVW
Download sequence
Identical sequences E1QQF2
gi|307595181|ref|YP_003901498.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]