SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307596044|ref|YP_003902361.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307596044|ref|YP_003902361.1|
Domain Number 1 Region: 15-311
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 8.84e-79
Family PFOR PP module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307596044|ref|YP_003902361.1|
Sequence length 315
Comment thiamine pyrophosphate domain-containing TPP-binding protein [Vulcanisaeta distributa DSM 14429]
Sequence
MKVYFRTIKDLPVDEYFGPGQLTCAGCGPSIAVRWLLKAAAPDVIVVNATGCIEVTTTSY
PYTAWSVPYLHVAFENSAAAASGVEAALKVLRRKGILDTKAKVMVIAGDGGTFDIGLQSL
SGMLERGHGVLYVLYDNEAYMNTGIQRSGGTPHFAWTTTSPVGSKLRGKVQRKKDIMSIV
IGHHIPYAATANIAYPIDLANKVKTALDYLDEGPAFIHVLAPCPPGWRYPEDMTVEIARL
ATETGYFPLYEWDHGRIRFNPPSNAHFDKSKRKPIIEYLKRQGRFAHLTEEDIKEIEKEI
DEYWDYLARLAKAFG
Download sequence
Identical sequences E1QNM2
WP_013337035.1.43420 gi|307596044|ref|YP_003902361.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]