SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325283672|ref|YP_004256213.1| from Deinococcus proteolyticus MRP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325283672|ref|YP_004256213.1|
Domain Number 1 Region: 279-498
Classification Level Classification E-value
Superfamily PHP domain-like 7.32e-41
Family PHP domain 0.0032
Further Details:      
 
Domain Number 2 Region: 4-84
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.000000000876
Family DNA polymerase beta, N-terminal domain-like 0.0049
Further Details:      
 
Domain Number 3 Region: 87-143
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.00000759
Family Achaeal helicase C-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325283672|ref|YP_004256213.1|
Sequence length 511
Comment PHP domain protein [Deinococcus proteolyticus MRP]
Sequence
MADVTRKDLVRALNATADLLDVLGSDEGGFRATAYRNAARSLDRHEASLEELQQTRFAGV
PKVGKGIAAELLAYLDSGRFAPLDEAAEGVPEGVQGLFAVRGLGPKKVRALWDAGIDSVP
ALRDAAQSGILAAVKGFGAKGAQTLGQAAQFVLDAQDRFLLSQATLAAEAVAGALAQAGF
GTEFSGDLGRSRDTLGGADLTVSGGEPAAWAQTLAALEGWAAGEQTAESLSGRWGGVPVR
LERGEPAALFLPFDEPEHAGLTLPEPAALLQVADIQGMLHTHSVWSDGTATLREMVAGVQ
TLGHAYLGTGDHSQSAAYAGGLTPPRLREYIAEIRALQAEGLPILAGAEVDILPDGSLDY
ADDLLAELDYVVASVHSGFGLSAADQTARLVRAASHPLVNILGHPTGRLLLRREGYALDI
DAVLDACAASGTAAEINANPWRLDLRWQDVLRWRGRVKFSINTDAHSVAGLRDLRYGVLM
AQKAGLTSADVVNCLDMAAFRAWARPVSSGG
Download sequence
Identical sequences F0RJM6
gi|325283672|ref|YP_004256213.1| WP_013615204.1.93574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]