SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325284652|ref|YP_004264115.1| from Deinococcus proteolyticus MRP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325284652|ref|YP_004264115.1|
Domain Number 1 Region: 4-551
Classification Level Classification E-value
Superfamily Urocanase 6.93e-247
Family Urocanase 0.00000000000119
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325284652|ref|YP_004264115.1|
Sequence length 557
Comment Urocanate hydratase [Deinococcus proteolyticus MRP]
Sequence
MTTEPRVIRAPRGPQKTAKGWIQEAAKRMLMNNLDPEVAEHPEQLVVYGGRGKAARTWEA
FDKIVETLDRLENDETLLVQSGKPVAVFRTFPHAPRVLIANSNLVPHWATWEEFDRLDAA
GLMMYGQMTAGSWIYIGTQGILQGTYETFAAAAKKHFGGSLKGTITVTAGLGGMGGAQPL
AVKLAGGVAICIEVDPTRIEKRLETRYLDEVANSLQDAIKKAEGYKAEGVARSIGVLGNA
AELVPALVEMNWTPELITDQTSAHDPMWGYIPPVRPDEDAGQLRAEHAEEYRARAYEAMA
GHVRAILELQKRGAVAFDYGNNLRQRALEAGVENAFDYPGFVPAFIRDSFCEGRGPFRWV
ALSGDPEDIYATDRALLELFPEDERLQSWLTYAADQIAFQGLPARICWLGYKERDQAARL
FNDMVRDGRLKAPIVIGRDHLDAGSVASPYRETEAMLDGSDAVSDWPLLNFATGIASGAA
WMSFHHGGGVGLGFSQHSGLVALADGSDEAAERLSRCLVNDPGMGVIRHADAGYEHAIET
ARERGIDLPSLGIGNRE
Download sequence
Identical sequences F0RPE9
gi|325284652|ref|YP_004264115.1| gi|325284652|ref|YP_004264115.1|NC_015169 WP_013622987.1.93574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]