SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325284800|ref|YP_004264263.1| from Deinococcus proteolyticus MRP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325284800|ref|YP_004264263.1|
Domain Number 1 Region: 22-413
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 9.03e-115
Family Homocysteine S-methyltransferase 0.00000353
Further Details:      
 
Domain Number 2 Region: 918-1230
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.06e-111
Family Methionine synthase SAM-binding domain 0.0000000497
Further Details:      
 
Domain Number 3 Region: 370-643
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.83e-87
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0011
Further Details:      
 
Domain Number 4 Region: 752-908
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.83e-42
Family Cobalamin (vitamin B12)-binding domain 0.00000303
Further Details:      
 
Domain Number 5 Region: 662-748
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.31e-26
Family Methionine synthase domain 0.00003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325284800|ref|YP_004264263.1|
Sequence length 1232
Comment methionine synthase [Deinococcus proteolyticus MRP]
Sequence
MTYTPPTPAQPPLTAQPSLAAHPLHRALQERILILDGAMGTMIQRHRLTEADFRGERLRD
HPLPLQGANDLLTLTQPQLIEEIHAAYFGAGADIAETNTFSSSRLGLAEYGVDDLIYELN
VQGARLARRAAERYSTPERPRWVAGAIGPTNRTASMSPDVNRPGFRAVTFDELVSSYSEQ
IHGLLDGGVDALLIETVFDTLNAKAALYAAEEVFGQQGRQVPIMVSGTITDASGRTLSGQ
TLGAFLASISHLPLLSVGLNCALGPAELRGHVQELSASTPFFTSAYPNAGLPNALGGYDE
TPQTMLDVMDEWLEQGWVNIVGGCCGTTPEHIRAFAAAAQRRSPRVPPHPSGLPTYAGLE
VLTLRPESNFLNVGERTNVTGSRRFLRLIRDRQFDEALDVAREQVEGGAQMIDINMDEAM
LDSQEAMVEFLNLIASEPDIARVPIMLDSSRFSVIEAGLKRVQGKAVVNSISLKEGEAEF
LRQAGVLRRYGAAAVVMAFDEQGQADTLERRIAICQRAYTLLTAHGFPPQDIIFDPNIFP
VGTGIPEHDRYALDFFEAARWIKANLPGALVSGGVSNVSFSFRGNSAVREAMNAAFLYHA
RQAGMDMGIVNPSTLEVYSEIEPELLERVEDVLLARRPDATERLLEYSEHVAGGAAKKER
DLSWREQPVAKRLEHALVRGITEFIVEDAEAARLELGGALKVIEGPLMDGMNVVGDLFGS
GKMFLPQVVKSARVMKQAVAHLEPYLQEGQGQRQSAGRVVLATVKGDVHDIGKNIVGVVL
ACNGFEVHDLGVMVPAERILDEAERLQADIIGLSGLITPSLDEMVGVAEEMQRRGLGARS
GGLPLLIGGATTSRVHTAVKIAPQYGGLTVHVLDASRSVGVTARAISEQERPGLAEEVAE
QYAKAREQFAQRGERRQILPLAQARAGAPQLSYAPVRPSFLGERPVTFNLKDLLPFIDWT
PFFIGWELAGRFPQILDDEVVGEQARSLYTDAQQALRDLVEGGRLEARGVVGFWPAERRG
DDVQLFTDDTRREEGATLHTLRQQGQQREGRPNRALADFVAPSGDYIGGFAVGIHGAEEI
IAGHKARHDDYAAIMTGLLADRLAEAFAEALHRQVRRELWGYAPDEELSNDDLIRERYQG
IRPAPGYPACPDHTEKGTLFRLLNARELAGLDLTESYAMTPPSAVSGLYFAHPDSGYFGV
GKLGTDQVEDYAARKGWSVAEAQRWLRPNLAE
Download sequence
Identical sequences F0RPU7
gi|325284800|ref|YP_004264263.1|NC_015169 gi|325284800|ref|YP_004264263.1| WP_013623135.1.93574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]