SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325284836|ref|YP_004264298.1| from Deinococcus proteolyticus MRP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325284836|ref|YP_004264298.1|
Domain Number 1 Region: 27-127
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 1.34e-22
Family ParB-like nuclease domain 0.0011
Further Details:      
 
Domain Number 2 Region: 119-247
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000000000889
Family KorB DNA-binding domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325284836|ref|YP_004264298.1|
Sequence length 309
Comment parB-like partition protein [Deinococcus proteolyticus MRP]
Sequence
MSGKPSTSALQAAMARASKAQSGIQAAEERHVPVEYLRLDDLDVSPSQARKDFQGIDELA
RDIAANGVLQPVLVRPLAGGRYQLVAGERRLRASRQAQQATIPAVIRDMTDLEARMHGLR
ENLQREDLNAYEVARAVLDLTALQLARPADEVQAELGGAAPAEETLRVLGEALKLVNKDL
TYLSYRRNYLSLLRLPAHLVAAIEQGASYSAVLAVRAATPEQQRVWLPLIISGEWSRRQV
QQALQEAKQTSQPANRPANKKKVPLADDWDRQMGQVSRKFTAKRLQSLDPRRRQKAQRLL
NELAQLLEE
Download sequence
Identical sequences F0RQV4
gi|325284836|ref|YP_004264298.1|NC_015170 gi|325284836|ref|YP_004264298.1| WP_013623170.1.93574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]