SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15678850|ref|NP_275967.1| from Methanothermobacter thermautotrophicus str. Delta H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15678850|ref|NP_275967.1|
Domain Number 1 Region: 9-154
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-20
Family GHMP Kinase, N-terminal domain 0.0049
Further Details:      
 
Weak hits

Sequence:  gi|15678850|ref|NP_275967.1|
Domain Number - Region: 227-310
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.000195
Family Galactokinase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15678850|ref|NP_275967.1|
Sequence length 329
Comment hypothetical protein MTH830 [Methanothermobacter thermautotrophicus str. Delta H]
Sequence
MVIELIINTPSRLHLTLIDLNGERGRLDGGVGITLNEPELVVGLEASDDMGVEFTSHAEG
KLREEYRSKIMEAARRTLKHIGSDEKFHFTVRSMFPAHSGLGSGTQLSLATARLVAEYHG
MKFTARELAHIVGRGGTSGIGVASFEDGGFIVDAGHSSREKSDFLPSSASSASPPPVIAR
YDFPEEWNIIIAIPEIDRSVSGRREVNIFQEYCPLPLRDVERLSHIILMKMMPAILEGDI
EAFGESVNEIQGTGFKRIERELQDPLIDRIIDSMISAGAPGAGMSSFGPAVYSVTDEKPG
NVAGAVAEIMGPGRIIVTGGRNRGAFMIK
Download sequence
Identical sequences O26918
WP_010876463.1.22989 gi|15678850|ref|NP_275967.1| 187420.MTH830 APC64841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]