SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15679348|ref|NP_276465.1| from Methanothermobacter thermautotrophicus str. Delta H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15679348|ref|NP_276465.1|
Domain Number 1 Region: 118-247
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 3.98e-28
Family MJ1460-like 0.028
Further Details:      
 
Domain Number 2 Region: 22-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000625
Family MarR-like transcriptional regulators 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15679348|ref|NP_276465.1|
Sequence length 251
Comment hypothetical protein MTH1349 [Methanothermobacter thermautotrophicus str. Delta H]
Sequence
MKRRHNFTIFSTETGIEVIESTVKSLILSELKKGALSFQEIVRITDKSKSTVSKHLSDLR
KAGLIVEMPDPEDRRRKLFEINSRYLGKLTRKRIDELDEEKTEFLAEHLTERGDPLEFFR
LMFHVLRVELIKEGINIDPVRHEAGKRIGEVIYPRIASEELGDLLENLRRFWMINRLGVL
EVESTDPLVIRAYECFECGLLHQIGESACALDSGILEAVFSRHFKGDVIVEETECYARGD
GRCSFRIVPES
Download sequence
Identical sequences O27403
187420.MTH1349 APC40722.0 WP_010876961.1.22989 gi|15679348|ref|NP_276465.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]