SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333923270|ref|YP_004496850.1| from Desulfotomaculum carboxydivorans CO-1-SRB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333923270|ref|YP_004496850.1|
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily L28p-like 1.06e-23
Family Ribosomal protein L28 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333923270|ref|YP_004496850.1|
Sequence length 62
Comment 50S ribosomal protein L28 [Desulfotomaculum carboxydivorans CO-1-SRB]
Sequence
MAKCEVCGKGITVGIKLSHSHIRTKRTWSPNLQRVKAIVDGSPKRIMVCTRCLRSGKVQR
AI
Download sequence
Identical sequences F6B334
WP_003543016.1.79281 WP_003543016.1.92302 gi|333923270|ref|YP_004496850.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]