SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333924450|ref|YP_004498030.1| from Desulfotomaculum carboxydivorans CO-1-SRB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333924450|ref|YP_004498030.1|
Domain Number 1 Region: 3-281
Classification Level Classification E-value
Superfamily Folate-binding domain 1.3e-107
Family Aminomethyltransferase folate-binding domain 0.000000193
Further Details:      
 
Domain Number 2 Region: 273-363
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 8.01e-26
Family Aminomethyltransferase beta-barrel domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333924450|ref|YP_004498030.1|
Sequence length 364
Comment aminomethyltransferase [Desulfotomaculum carboxydivorans CO-1-SRB]
Sequence
MSELKRTPLYDEHLAAGAKMVEFGGWLMPVQYEGILKEHETVRSAAGLFDVSHMGEIQIT
GPGARELIQSIITNDVNRLTPGAALYTPMCHPTGGTVDDLLVYQLEENQYLLVVNAANIE
KDYNWVKVYANEGVEVKNVSDVTCQLALQGPRAIKILQKLTSVDLNEIKHFHFVYGPVEG
INCLISRTGYTGEDGFELYFPAEHARLLWRAILAAGQGEGIKPVGLGARDTLRFEACLAL
YGHELTDSVSPVMAGLGWTVKFNKGDFVGREALLQQKETGPSHKLVGLEMIDRGIPRQGY
TISKDGQEVGWITSGTFAPSIGKNLGLGYVAAQWVAVGTELDIMVRGKALKAKIVPKPFY
KREG
Download sequence
Identical sequences F6B387
gi|333924450|ref|YP_004498030.1| WP_013810661.1.92302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]