SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333922715|ref|YP_004496295.1| from Desulfotomaculum carboxydivorans CO-1-SRB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333922715|ref|YP_004496295.1|
Domain Number 1 Region: 9-244
Classification Level Classification E-value
Superfamily PLP-binding barrel 7.85e-76
Family Alanine racemase-like, N-terminal domain 0.00000392
Further Details:      
 
Domain Number 2 Region: 237-371
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.49e-53
Family Alanine racemase 0.0000263
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333922715|ref|YP_004496295.1|
Sequence length 372
Comment alanine racemase [Desulfotomaculum carboxydivorans CO-1-SRB]
Sequence
MQEPIWAEIDLGAIRHNIKEVRRLVGPDREIMAVVKANGYGHGAVPVARAALSAGATRLA
VARLNEAMVLRQAGINVPILVLGFIPPEQLATALTNHITLTLYRTDLAEEISRVAQKLGQ
PAVIHLKVDTGMGRLGFIPEQGIEEVKRVSQLAGLKLEGIYTHFAAADETDKSYTRWQLD
RFLSFISALEEQGVSFALRHCANSAAIIDHPEAYLDMVRPGIIIYGLYPSEEVNKSRVDL
RPAMALKTRVAHLKTVKPGTKISYGCTYTVPRETVIGSLPLGYADGYPRLLSSRGQVIIR
GQRAPIVGRVCMDQSMVDVGHIPGVKVGDEVLIFGRDGADYLPVEEVAAWLGTINYEMVC
LVGARVPRIYKE
Download sequence
Identical sequences F6B7D3
WP_013809651.1.92302 gi|333922715|ref|YP_004496295.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]