SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323356488|ref|YP_004222884.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323356488|ref|YP_004222884.1|
Domain Number 1 Region: 5-479
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 1.83e-200
Family Heme-dependent catalases 0.0000000000679
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|323356488|ref|YP_004222884.1|
Sequence length 509
Comment catalase [Microbacterium testaceum StLB037]
Sequence
MTEPTTTNGGAPVASDEHSQSVGADGSIALTDHYLIEKLAQFNRERVPERVVHAKGGGAF
GTFRTTGDVSAYTRAALFQPGVETEMLARFSSVAGEQGSPDTWRDPRGFSLKFYTTEGNY
DLVGNNTPVFFVKDGIKFPDFIRSQKRLPGSHLRDNTMQWDFWTLSPESAHQVTWLMGDR
GIPASWRHMNGYGSHTYQWINAEGERFWVKYHFHTDLGHKTLTQDEADQIAGQDADFHIR
DLYAAIERNEFPTWTLKVQIMPYEDAKTYRFNPFDLTKVWPHSDYPEIEVGTMELNRNPG
NYFAEIEQAAFEPSNFVPGIDGSPDKMLQARIFSYADAHRYRVGTNYQQLPVNRPHTEVH
SYSKEGAMRYEYNPPEVPVYAPNSAGGPAADPRRAGDGGWQSDGELVRSAATLHPEDDDW
GQAGTLVREVMSAEARDRLVETITGHVGGVTRKDVRDRAVQYWKNVDAEIGSRLEAALPP
LESSTAPGEQLSEPNPDGDLVGTDVAGNI
Download sequence
Identical sequences E8N7H1
gi|323356488|ref|YP_004222884.1| WP_013583131.1.25428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]