SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323356860|ref|YP_004223256.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323356860|ref|YP_004223256.1|
Domain Number 1 Region: 3-295
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.47e-75
Family ATP synthase (F1-ATPase), gamma subunit 0.0000418
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|323356860|ref|YP_004223256.1|
Sequence length 299
Comment F0F1-type ATP synthase, gamma subunit [Microbacterium testaceum StLB037]
Sequence
MGAQLRVYKQKISSAQTTKKITKAMELIAASRIQKAMARVRAASPFARAVTSAVSAVATY
SSVDHPLTTERENIRRSAVVIFTSDRGLAGAFNSQILREGLELAELLRSQGKEVVFYLVG
RKAVGYFQFRRMASVEQWVGDTDTPQFSTAEEISEAVLKAYRAGGENDGVDEIHLVYNRF
VSMMTQSPESVRLLPLEVIEADEAPAQSEIYPLYEFEPDAETVLDALLPVYVQSRIFNAL
LQSSAAKHAATQKAMKSASDNADKLITDYTRLRNNARQAEITQQIAEIVGGADALASGK
Download sequence
Identical sequences E8NAV4
WP_013583503.1.25428 gi|323356860|ref|YP_004223256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]