SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323357279|ref|YP_004223675.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323357279|ref|YP_004223675.1|
Domain Number 1 Region: 3-185
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.1e-39
Family Phosphoglucomutase, first 3 domains 0.00088
Further Details:      
 
Domain Number 2 Region: 262-368
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.18e-32
Family Phosphoglucomutase, first 3 domains 0.0056
Further Details:      
 
Domain Number 3 Region: 162-261
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.06e-24
Family Phosphoglucomutase, first 3 domains 0.0015
Further Details:      
 
Domain Number 4 Region: 362-449
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 9.68e-21
Family Phosphoglucomutase, C-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|323357279|ref|YP_004223675.1|
Sequence length 451
Comment phosphomannomutase [Microbacterium testaceum StLB037]
Sequence
MPLFGTDGVRGLANGLLTAELALHLAQATAVVLGQGRSAEARKAEGRRLTAVVARDPRVS
GEFLSAAVAAGLASSGVDVLDAGVIPTPATAFLIADRDADFGVMVSASHNPAPDNGIKIF
ARGGTKLPDIVEQRIERALEGERLQPTGAGVGRIRRFADAEDRYVLHLLGSLPHRLDGIH
VVLDCAHGAAAGVSPETFKDAGATVTVIGADPDGLNINDGVGSTHLDVLAETVVRLGADV
GIAHDGDADRCLAVDAQGNVVDGDQIMAILAVAMKERGTLVDDTLVATVMSNLGLHRAME
AHGIRVLQTGVGDRYVLEAMNEGGYSLGGEQSGHVIMSDFATTGDGLLTGLHVVAEMARQ
GKTLAELASLMTVYPQVLVNVRGVDRDGVGDEGVQAAVAASTAELGDSGRVLLRASGTEP
LVRVMVEAASEDVARAHADRLAEVVRERLAL
Download sequence
Identical sequences E8NEC9
WP_013583922.1.25428 gi|323357279|ref|YP_004223675.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]