SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|323357450|ref|YP_004223846.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323357450|ref|YP_004223846.1|
Domain Number 1 Region: 2-123
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 4.82e-22
Family N-terminal domain of MutM-like DNA repair proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily S13-like H2TH domain 2.5e-16
Family Middle domain of MutM-like DNA repair proteins 0.0037
Further Details:      
 
Domain Number 3 Region: 213-257
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000097
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|323357450|ref|YP_004223846.1|
Sequence length 258
Comment formamidopyrimidine-DNA glycosylase [Microbacterium testaceum StLB037]
Sequence
MPEGDTVYRAAAKLSAALAGKVVTRFDIRVPGSATADLRGETVHEVAARGKHLLHRIGGY
TLHSHLKMEGRWDVYRPGERWRRPAFKARAIVGVAGADAVGFDLAMVEVLRTTDEHTVIG
HLGPDLLADDWDEAEAVRRVGADTREVHVALLDQRNVAGFGNVYANELLFVRGIAPTTPA
TEIDVPATIALGERMIRANLPRPERTFTGDTRPGRRFWVYGREGAPCRRCGTPIRATALG
ASATSERNVYWCPTCQPG
Download sequence
Identical sequences E8NFS1
WP_013584093.1.25428 gi|323357450|ref|YP_004223846.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]