SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323358006|ref|YP_004224402.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323358006|ref|YP_004224402.1|
Domain Number 1 Region: 59-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 6.67e-22
Family Ribosomal protein L9 C-domain 0.00052
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.49e-16
Family Ribosomal protein L9 N-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|323358006|ref|YP_004224402.1|
Sequence length 150
Comment ribosomal protein L9 [Microbacterium testaceum StLB037]
Sequence
MAKLILTNEVTGLGSAGDVVEVKNGYARNYLIPQGFAVAWSRGGEKQVASIRAARESRAI
HAHEDAVALKNSLESNTVKLAVKAGNEGRLFGSVKPADVADAVQAAGLGELDKRKIQITS
AIKSVGQHEATVRLRDDVTAVITLQVVAAK
Download sequence
Identical sequences E8N9Q3
gi|323358006|ref|YP_004224402.1| WP_013584647.1.25428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]