SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|323358658|ref|YP_004225054.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|323358658|ref|YP_004225054.1|
Domain Number - Region: 29-98
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.000209
Family Heme-dependent catalases 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|323358658|ref|YP_004225054.1|
Sequence length 289
Comment 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Microbacterium testaceum StLB037]
Sequence
MTAPTGIPPLHRSPVARALGSLLASGFSLLQRLRPPRPIHSRGVVLRGEMRWIPDAAPAG
VSFVDDAPPGPVPVVARVSRSVGLPAPLPDIIGLALRIDVQAWARRGGEGPDPDDGILER
GRTGGRRASLSGATAASRAVADIELASTGWNVPARFALLPRRRAERARLGTLLPFRGARG
PVLFIARTSAGRPPATDPRKVTGARDTAWVLTLGHATAVGPWHPFARLELHLDPDQDARG
LRFDAVRRPVPGAESYAWVRAARQPSYVRVQLDDAELRTPTDQPAAAGR
Download sequence
Identical sequences E8NFA1
gi|323358658|ref|YP_004225054.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]