SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307352341|ref|YP_003893392.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307352341|ref|YP_003893392.1|
Domain Number - Region: 64-127
Classification Level Classification E-value
Superfamily SIS domain 0.0445
Family mono-SIS domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307352341|ref|YP_003893392.1|
Sequence length 279
Comment ABC-2 type transporter [Methanoplanus petrolearius DSM 11571]
Sequence
MKFGFLNIYKRDMTRFFRFKHQLFSSLLQPALWLGFFGMAMAGNFDRILGGTGEAVSGTM
SVDYLTFMCAGVIAATILFTNIFGGFILLFDKNWGIFREILASPMSRKDIIIGIAMSGIT
KSWIQAIIVIVFGLILGVAFFTGKGPFGIIFSLAGILLFIALFSIAFISLSAIIALKMDS
PEGFQGISTLLTMPLFFVSNALYPATGLPVVLQQIAEVNPLTHLTAGIRYFAIGGDFTAI
GMHFVYTTTDMLVSLGYLALFAGVIFAIAWRVVDKVVIT
Download sequence
Identical sequences E1REK7
gi|307352341|ref|YP_003893392.1| WP_013328133.1.58734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]