SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307352831|ref|YP_003893882.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307352831|ref|YP_003893882.1|
Domain Number 1 Region: 203-495
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 6.22e-118
Family AICAR transformylase domain of bifunctional purine biosynthesis enzyme ATIC 0.0000021
Further Details:      
 
Domain Number 2 Region: 2-187
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 5.49e-60
Family Inosicase 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307352831|ref|YP_003893882.1|
Sequence length 495
Comment phosphoribosylaminoimidazolecarboxamide formyltransferase/IMP cyclohydrolase [Methanoplanus petrolearius DSM 11571]
Sequence
MKYALLSVWDKTGIVDLARTLVENDFKLLSSGGTAKELSNAGIEITEVSEYTGAPEMMDG
RVKTLHPKIHGGLLGRRGIDDAVMAERGIEKIDLLVVNLYPFEDMSGKGLPLNELVEYID
IGGPAMIRAAAKNFRDVAVVTDPKDYDFIKAAVKENGLTEAERLYLARKVFSRMAAYDGA
ISNYLYSIESEFPEVFSVQFRNGRELRYGENPHQKAAVYGESGIAGQKSLQGKAMSYNNY
LDTDSAVRLLREFDETAAVIVKHNNPCGVAVGDTLHEAYIRARDVDPVSAYGGIVALNRE
VGPDMAEEIASTFIEVVIAPSYTREALEIMKRKENMRVLVLPPDEETQELRTIDGGALVQ
KTPKDITENWEVVTEREPTADEMEAMKLAMKICKHTKSNAIIFADKKSALGIGAGQMNRV
NSAEIAVSKAQFSLKGSAVASDAFLPFPDTLEVAAKAGATALLQPGGSIRDKEVIEAANR
LNVAMVFTGVRHFRH
Download sequence
Identical sequences E1RID1
gi|307352831|ref|YP_003893882.1| WP_013328622.1.58734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]