SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307352833|ref|YP_003893884.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307352833|ref|YP_003893884.1|
Domain Number 1 Region: 164-355
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.34e-65
Family Actin/HSP70 0.000000823
Further Details:      
 
Domain Number 2 Region: 357-513
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 1.05e-57
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.00000189
Further Details:      
 
Domain Number 3 Region: 6-161
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.66e-57
Family Actin/HSP70 0.00000412
Further Details:      
 
Domain Number 4 Region: 507-581
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.000000902
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307352833|ref|YP_003893884.1|
Sequence length 614
Comment chaperone protein DnaK [Methanoplanus petrolearius DSM 11571]
Sequence
MASNKVLGIDLGTTNSCMSIMEGGKPVVIPNAEGARTTPSVVAFSKDGERLIGSVAKRQA
VTNPDRTIISIKRDMGTDRKIKIDDKVFTPQEISAMILQKLKVDAEAYLGEEIKKAVITV
PAYFNDAQRNATKDAGKIAGLEVMRIINEPTASALAYGIEKEGDATVLVFDLGGGTFDVS
ILTLGDGVFEVQATAGDNHLGGDDFDHLVVKYLVDEFKKQEGIDLSSDKMAMQRLRDAAE
NAKKELSTVQKTNINLPYITTDSSGPKFLDIDLTRAKFEQLIGDLVDRTIGPVKQALSDA
KLTAKDIDHVLLVGGSTRVPLVQERVKALLAKEPDKGINPDECVAVGASIQGGVLTGEAK
DVVLLDVTPLTLSIETLGGIATKLIERNTTIPTKKSQIFTTAADNQTSVEIHVVQGERAM
ASDNFTLGKFQLTGIPPAPRGIPQIEVTFDIDANGIINVSAKDLGTGNQQAITISGDKRL
SKDEIDEMVNKAKDFEDADKKKREEIEIKNSADNSVFAAEKLLKDSADKIEAEDKGKIES
ALEKVKNTMEGEDIEALKKDVEELQEAVFAATTKIYQKAQAEAEAAKAGEAGSAGEDETV
VDADYEVKDDEKKE
Download sequence
Identical sequences E1RID3
WP_013328624.1.58734 gi|307352833|ref|YP_003893884.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]