SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307353209|ref|YP_003894260.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307353209|ref|YP_003894260.1|
Domain Number 1 Region: 49-330
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.01e-58
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00022
Further Details:      
 
Domain Number 2 Region: 329-555
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 9.03e-50
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.0000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307353209|ref|YP_003894260.1|
Sequence length 556
Comment 5'-nucleotidase domain-containing protein [Methanoplanus petrolearius DSM 11571]
Sequence
MKESSGLKSVTVIGLLLVVILLIFSVFVLENAFSGSDEGNAEDIAGYSGNLRVLTTPDIH
SHLFSMSENDTGTRIGRIGALAETLGEKNEDTIYLFAGDLGEGGFYHMYSGVPEAGAYSM
AGIDAAVLGNHAFDFNNSLLKVWATNASFPILCANIDFSDDVLNETVKDYVILDSGDAKI
GVFGILLPQLGEFVEIPGGVVIYENTTAIAESVVKELEDQDVDVIIALTHQYEDEDVELA
ESVSGIDLIIGGHDHLVWNRTVTAPDGSSTLIVHAGKYGEETDSVDLVFENGEVTGTSIE
RYQITEDMPVDPEITSFIMPYYENYTSSLSEPIGKTLVPLDATYETIRTNESNAGDLITD
AIRTNVPGVDIALINSGSIRGDCIIPAGEMSYLTLETLLPFENMIVTVQMTGDEVKDTLE
RSASAIVFPGEEEGNVHKLSSGGFLQVSGVRFDINSSGESFTADFNNDTIISKGDRIENL
TVVTTDGIAPIDPDAVYTVAVNDYLAGGGNGYTNIRAISDDKKVNTEINVIGLLASDIEE
NSPISPECDGRIRVLG
Download sequence
Identical sequences E1RKG9
WP_013329000.1.58734 gi|307353209|ref|YP_003894260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]