SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307353661|ref|YP_003894712.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307353661|ref|YP_003894712.1|
Domain Number 1 Region: 126-395
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.01e-102
Family BC ATP-binding domain-like 0.000000182
Further Details:      
 
Domain Number 2 Region: 657-916
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.42e-101
Family BC ATP-binding domain-like 0.000000209
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.01e-43
Family BC N-terminal domain-like 0.00000849
Further Details:      
 
Domain Number 4 Region: 535-659
Classification Level Classification E-value
Superfamily PreATP-grasp domain 4.89e-43
Family BC N-terminal domain-like 0.0000112
Further Details:      
 
Domain Number 5 Region: 390-530
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 2.75e-36
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00016
Further Details:      
 
Domain Number 6 Region: 920-1054
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 1.15e-33
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307353661|ref|YP_003894712.1|
Sequence length 1055
Comment carbamoyl-phosphate synthase large subunit [Methanoplanus petrolearius DSM 11571]
Sequence
MPRREDIKKVILIGSGPIQIGQAAEFDFSGSQACRALREEGVEVVLVNSNPATIQTDPDT
ADVVYVEPLKAGIIAKIIEKEKPDGILSGMGGQTGLNLTAELAEMGALEDVEILGTPLEA
IYKGEDREKFRDLMNDIGEPIPRSMILRSMDQLDNALEIVGLPAIIRPAYTLGGAGGGVA
HTPEELRKIVEIGLQRSRIHQVLIEESVMGWKEIEYEVMRDSFDTCLIVCGMENVDAMGI
HTGESVVVAPILTLTDEEFHLLRTAAIKIIRALDVQGGCNIQMAFKDGDYRIIEVNPRVS
RSSALASKATGYPIARVAAKIAIGLRLDEIMNSVTGCTPASFEPSIDYVVVKIPRWPFDK
FKNADRTLTTAMKSTGEVMSIGRTLEEAFMKAMRSLDTDINSHTDKDEIRMLLQNPTDER
FGCLFDAFRQGFTVEEVSALTFIDVFFLQKIENLVEIEKKLKSGSVSEDDIRNAVHYGFS
VTEIGELTGKPEKEIEAIAGLPVYKLVDTCAAEFPAKTPYFYSTRDEGCEIDRDGKQKIL
ILGSGPIRIGQGIEFDYCTVHAVMALREEGIEVHIVNNNPETVSTDFDTSDRLFFEPMKL
EDVMNILRKDDYYGVMVQFGGQNSVNLATSIEEKIKEYGLKTKILGTSPAAMDLAEDRDQ
FSRLLERLDIPSPANGSAHSETEAMQVAKKIGYPLLVRPSYVLGGRAMELVHDDIELRNY
IKEAVKVSRKHPVLLDSFLQNAIEIDVDAVCDGEDVLIGGIMEHIEEAGVHSGDSACVIP
SQSLSKNVIATVKDYTRKLALGIGVVGLINIQYAVKDEVVYVLEANPRASRTVPFVSKAT
GIPLAKIAARVMTDGKLKTYGITEKKLSHVSVKEVLLPFNKLPGVDITLSPEMKSTGEVM
GIDYDFGRAYYKACISAENQLPLEGKVFISAGSEFKQDFVPIAKKLCSLGLSIVGTKGTV
ETLRENGIEADLVRKVQEGSPNVIDFMRRGEINLIINTPSGKYSRQDHMQIMRAALDYNT
PYITTIQAAKAAAMAIESMKKGDITIEPLSHYHEN
Download sequence
Identical sequences E1RG39
gi|307353661|ref|YP_003894712.1| WP_013329451.1.58734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]