SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332291318|ref|YP_004429927.1| from Krokinobacter sp. 4H-3-7-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332291318|ref|YP_004429927.1|
Domain Number 1 Region: 1-198
Classification Level Classification E-value
Superfamily CutC-like 2.09e-65
Family CutC-like 0.00000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332291318|ref|YP_004429927.1|
Sequence length 238
Comment CutC family protein [Krokinobacter sp. 4H-3-7-5]
Sequence
MKLEICANSFESALAAQDAGAHRIELCQELSLGGITPSNGLIEKVMQELDIPVFVLIRPR
SGDFMYSEADFDVMLRDIAFAKAQGAHGIVSGILNTDFKIDAERTERLITECGELPFTFH
RAFDWTPDVLAALELLIDMGAQRVLTSGMNVNVNEGYETLVQLLAAARNRIGILPGGGIS
VDNVMKFKNAGFSEVHGSLSSNAFGYNHPIKMHSLAGHENNLLQTSDVFKIKALLNML
Download sequence
Identical sequences F4B1S0
gi|332291318|ref|YP_004429927.1| WP_013750167.1.5237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]