SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340616689|ref|YP_004735142.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340616689|ref|YP_004735142.1|
Domain Number 1 Region: 462-612
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.96e-28
Family Histidine kinase 0.0037
Further Details:      
 
Domain Number 2 Region: 245-374
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.64e-20
Family PYP-like 0.083
Further Details:      
 
Domain Number 3 Region: 13-122
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000613
Family N-terminal PAS domain of Pas kinase 0.068
Further Details:      
 
Domain Number 4 Region: 141-248
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000162
Family Heme-binding PAS domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340616689|ref|YP_004735142.1|
Sequence length 616
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MLNGTKTIQNNPLVKQLPSATVFTNKKFEVVYASDKFVRDFGFDSQLVFGKPINELFTTL
SDNWENTLYNCLSNSSEHLNVTYSLKSEADAKWYKWSCTAWLNDTNETMGLIIHFNDITE
EKLKGEKVAKLQSLLDATCEISKIGVWEYDFMSDTLIGCDVIREIYGVSKDYKFSFDSAI
SQYKDGHSRNTIAMHVHDTLMNGKTWNEKLQFKTIKGKEIWVQVAGMPTYIDGKIVGLKG
TLQNIEEQIRREAKTKENELLMRTLIDNLPLNVFIKDTESRKILVNKSECEYMGVENPDQ
LLGKNDFDLFDKDVAQISRAEDLHVMETLIPMLGRETTSRTKDGKMVTFLTSKIPLKSNN
GKAQGLVGISMDITDLKQKEQELRDLINVTSQQNKKLVNFAHIVSHNLRSHTANFSMLLD
FLAHEKNENEKVKITEMLTQASDNLLETLENLNEVVAINTNINLKKKPVRLNQRIASVKH
NLKPFFTSNEARIINTISDDVKINVIPSYIDSILMNFFTNAIKYKHPDRSPIIRLETKHE
EGYTILSISDNGLGIDLNKYGEKLFGMYKTFHDHSDSRGIGLYITKNQIEAMNGKVTVAS
EVGVGTTFKIYFNEQN
Download sequence
Identical sequences G0L1J6
gi|340616689|ref|YP_004735142.1| WP_013992063.1.92583 WP_013992063.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]