SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340616695|ref|YP_004735148.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340616695|ref|YP_004735148.1|
Domain Number 1 Region: 2-188
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.58e-41
Family Biotin holoenzyme synthetase 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340616695|ref|YP_004735148.1|
Sequence length 243
Comment biotin-[acetyl-CoA-carboxylase] ligase [Zobellia galactanivorans]
Sequence
MQLIKLNATDSTNAYLKRLLPDSSLTDFTVVMAEEQLKGKGQMGAVWESEAGKNLTISVL
KNELHLVADDFFALNICVSLAVYDVLKAYQVPNLSIKWPNDILSGTSKICGILIENLLSG
GQINTAVIGIGLNVNQTFFGNVENASSLKLILGKNFNLDELLHAIVESLKQNFLKIKVGP
MVKLWQAYEEVLFRKDKPSTFENRNGELFMGFIRGISPKGKLVIALEDNIMQEFDIKEVK
LLY
Download sequence
Identical sequences G0L9R1
WP_013992069.1.92583 WP_013992069.1.951 gi|340616695|ref|YP_004735148.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]