SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340616744|ref|YP_004735197.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340616744|ref|YP_004735197.1|
Domain Number 1 Region: 125-238
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.26e-22
Family UbiE/COQ5-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340616744|ref|YP_004735197.1|
Sequence length 256
Comment hypothetical protein zobellia_740 [Zobellia galactanivorans]
Sequence
MSKIFKFILNAVPRPLLIKLSYLVRPLLGLWMRGNRYEDPIDGKRFKRFLPYGYESPREN
VLAPYTLSLERHRLLWLYLKHRSNFFTENLKVLHFAPEQAFYKRFRKLKNLDYTTTDLFS
PLADVKADICNLPFEDNSFDVILCNHVLEHIPDDTKAMQELYRVLKKGGWGILQIPQDLE
RETTFEDDSITDKKERTKIFGQYDHVRIYGRDYFDKLRSIGFIVEEVDYTATLSPEDIDR
YRLAKGEIIPLVKKPA
Download sequence
Identical sequences G0L9T2
gi|340616744|ref|YP_004735197.1| WP_013992118.1.92583 WP_013992118.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]