SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340616804|ref|YP_004735257.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340616804|ref|YP_004735257.1|
Domain Number 1 Region: 2-106,205-297
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.09e-41
Family MraW-like putative methyltransferases 0.00034
Further Details:      
 
Domain Number 2 Region: 107-205
Classification Level Classification E-value
Superfamily Putative methyltransferase TM0872, insert domain 1.05e-27
Family Putative methyltransferase TM0872, insert domain 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340616804|ref|YP_004735257.1|
Sequence length 299
Comment S-adenosyl-methyltransferase MraW [Zobellia galactanivorans]
Sequence
MYHNPVLLQESVDGLNIKENGVYVDVTFGGGGHSRKILEYLGSEGKLFAFDQDEDALANA
IDDPRFTLINENFRFIRQFLKFYGIRKVDGILADFGVSSHQFDKAERGFSTRFEADLDMR
MSKRNLLSAYEVVNNYDYDDLRRVLFQYGDLRNANAMAKTILAKREEAPIKTTEMLKEAL
QKFLPKAKEHKILAQIYQAVRIEVNQEIAVIEEFLLQTPELLDEGGRLSVISYHSLEDRL
VKRFIREGQFQGEAPKDFYGNVDVPFKKVGSLIVPSKEEIARNNRARSAKLRIAERIIK
Download sequence
Identical sequences G0L9V7
WP_013992178.1.92583 WP_013992178.1.951 gi|340616804|ref|YP_004735257.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]