SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340616973|ref|YP_004735426.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340616973|ref|YP_004735426.1|
Domain Number 1 Region: 2-254
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.08e-101
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000206
Further Details:      
 
Domain Number 2 Region: 255-470
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.31e-65
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000347
Further Details:      
 
Domain Number 3 Region: 551-708
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 8.37e-46
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.06
Further Details:      
 
Domain Number 4 Region: 460-538
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000000000847
Family AlaX-M N-terminal domain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340616973|ref|YP_004735426.1|
Sequence length 871
Comment alanyl-tRNA synthetase [Zobellia galactanivorans]
Sequence
MTSKEIRSQFLNFFKEKGHKIVPSAPMVIKDDPTLMFTNAGMNQFKEFFLGNSVAKNPRA
VDSQKCLRVSGKHNDLEEVGKDTYHHTMFEMLGNWSFGDYFKKEAIEWAWELLTEVLKID
KDCLYVSVFEGSKDADKLDLDTEAFDLWKAIVPEDRIILGNKKDNFWEMGDQGPCGPCSE
IHVDIRSAEEKAKVPGASLVNADHPQVVEIWNLVFMQYNRKADGSLEPLPARHVDTGMGF
ERLCMVMQGVQSNYDTDVFKPIIREIETITHSKYGKDEEIDIAIRVIADHIRAVSFSIAD
GQLPSNTGAGYVIRRILRRAVRYGFTFLNTKEPFMYRLVNVLTEDMGEAFPELKEQRQLI
ENVIKEEEYSFLKTLEQGLVLLDQVILNVKGKEVDGRKAFELYDTYGFPIDLTALILSEK
GLTLDEKGFELAMQEQKNRSKSASEISKDDWEVLSSDLEQEFVGYDMLETNVKLVKYRKV
TSKKAGEQYQLVFNLTPFYPEGGGQVGDKGYLEMPNGDVVYILDTKKENNEIIHFTKNLP
ADLNGTFRAVVDKKQRERTQANHTATHLLHQALREVLGKHVEQKGSAVHSKYLRFDFSHF
SKVTPEELREVENFVNARIAGQLPFEEQRNIPVEKALEEGAMALFGEKYGDTVRTVRFGR
SIELCGGTHVKNTGDIWHFKIKSEGAVASGIRRIEAITSDAVKDFYAENDRVLLDIKGLL
NNAQDPVKAVSTLQEENAKLKKEVEALLKDKAKNLKIELKNELQEVNGVQFLAKKIDLDA
AGIKDLSFEMGQNQDNLFLLFATEQNGKALLSCYISKELVGAKDLNAGTIVRELGKFIQG
GGGGQPFFATAGGKKPEGIDEALAKAKDYIK
Download sequence
Identical sequences G0L2K1
gi|340616973|ref|YP_004735426.1| WP_013992347.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]