SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340617082|ref|YP_004735535.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340617082|ref|YP_004735535.1|
Domain Number 1 Region: 825-998
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.8e-34
Family Histidine kinase 0.0016
Further Details:      
 
Domain Number 2 Region: 508-616
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000332
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.034
Further Details:      
 
Domain Number 3 Region: 643-746
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000971
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.029
Further Details:      
 
Domain Number 4 Region: 754-835
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000051
Family Homodimeric domain of signal transducing histidine kinase 0.0059
Further Details:      
 
Domain Number 5 Region: 392-483
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000192
Family PYP-like 0.039
Further Details:      
 
Domain Number 6 Region: 217-326
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000135
Family BphP N-terminal domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340617082|ref|YP_004735535.1|
Sequence length 999
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MDFKRIYQSSKTYIVLLIISFAIILFTANMAYYQIMRMQDLAEKVAHTLQVNNAISELSA
HYTQAESEEFRKQLKTVDTNDALFNSYKEDGTKILDTLRKLTASDSSQQIRLAPMQLLLD
TLYEDLYNLSKEPTANSDTLSLEDAEKLQKNNINFTLYRIRNIKNQMLAEERLSIKNARS
EYDTNKYLAPLTSLFLAFFALLVFVLAFFKIYRNKLRIRRSEGFLRSVLATTDNIVNYYE
PIFDTQKKIIDFKISFANECNRDYLGLDPDEIIGERISKVFPFLMLDGEFEKLVTCYTEK
KKITLDRQILGPNQRLWFKSIITPLADGIMVTARNSTAEEKAKEEQLLLNQQLEEQNLEL
LDHRAFLNNIFKSISHVVMNFESVRDGSGAIIDFKILFINDKITPITGDLPQEIINKNIS
SVFPTIFETEIFGYLKEVVNSGKPTSYEVPYEVDGKTKWFSARAIKLGDGITLTTREITE
EKEKTDELLHLNTQLETQNSIFIDAENVANIGSYIWYLDNGEATISDNFYRILGYEPNAF
KINYDSYRRFVHPDDREMYDQLGKETSEHGQSQVNGYRIITKQGDIKHIELNGRSMIRNG
RKASVGVVLDVTEEKEKTNRVAALNQELSIQNSILTDAERIAKIGSFIWHVGTDEIEISD
NFYRMIGFEPKGFKSSLKAFRKFIHPEDVKMFDENIENSTKELKVKEHRYRIITTEGEVK
HFEVNGQLIEKNNTSVMLGVAQDITQNIAAEEKLRASNLQLQHSNAELESFNRVASHDLQ
EPLRKTQMFISRLESTEAENLSEKGRIYFQKVVNAASRMQSLVLNLLTYSRIDSKHEDFD
LIDLNEVLKKVKEDLSSNITDTGALIKSEDLPSIKGVSYQLEQLFNNLISNALKYRAVEA
VPTITIQAEKVHSKQIPENFFKTANTYYKITVIDNGIGFSSEHAEKIFEVFQRLHQKSEY
SGTGIGLAICKKIIENHHGFIYATSELGKGSAFIFYLPA
Download sequence
Identical sequences G0LA91
gi|340617082|ref|YP_004735535.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]