SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340617266|ref|YP_004735719.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340617266|ref|YP_004735719.1|
Domain Number 1 Region: 202-370
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-38
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 2 Region: 15-124
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.5e-23
Family N-terminal PAS domain of Pas kinase 0.042
Further Details:      
 
Domain Number 3 Region: 131-214
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000000902
Family Homodimeric domain of signal transducing histidine kinase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340617266|ref|YP_004735719.1|
Sequence length 377
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MELDYGIYHDGKYTQTILNNMGDSVFVKDIHSKIVMVNDAFCKLVDLSRENIIGKTLAEI
VSPTEREGFLKIDQQVLSDGIECIREETMTLQGGEKRILSTRKSRFIDENGEKFLLCVVR
DITESKKAEETLHQNEAELKKIGETKDKLLSIIAHDLRSPFNNITMLSDMASNAIASNNL
SQSKECLELIDTTTQNAICLLDNLLSWAKSQSGQIDIISDQINLGQIVNETLELSKAIAK
TKNISLNYIENKNIEVVSDPKVIKTIIRNLVSNAIKFTPSGGHINISTVSNKEQVEVTVA
DNGIGMSQEECQKLFNINSDHGRIGTAKEKGSGFGLILSKDLAEKIGGKIWANSIQGKGS
QFKFTIPLRTEPEEALS
Download sequence
Identical sequences G0LAI1
WP_013992640.1.951 gi|340617266|ref|YP_004735719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]