SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340617419|ref|YP_004735872.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340617419|ref|YP_004735872.1|
Domain Number 1 Region: 583-729
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.19e-29
Family Histidine kinase 0.0021
Further Details:      
 
Domain Number 2 Region: 363-491
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.8e-24
Family Flavin-binding PAS domain 0.063
Further Details:      
 
Domain Number 3 Region: 258-367
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000015
Family Flavin-binding PAS domain 0.042
Further Details:      
 
Domain Number 4 Region: 9-120
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000011
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.083
Further Details:      
 
Domain Number 5 Region: 135-235
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000419
Family Heme-binding PAS domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340617419|ref|YP_004735872.1|
Sequence length 737
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MQTLSITSLIKDSPSAVAILNTELCFVAYSQVWLNDFCKDQSSIAGKNYLDVLPRTPEAL
NSILEECLSKGAKNVCEGQKFIYPDGTLQWLKWKINAWTDDSGEIGGLIILLEDVTEAKR
REEILAKAERVGRIGGWEIDLSTNQLFWTDITREIHEVPNDFQPDIETGINFYKEGIHRE
EITRLISNAFADGTPWDTELILVTAKGNEIWVRAKGEVEMANGKCVRIFGTFQDINHKKK
IELGFKKVRERLALATQGAGVGIWEYDLVSKTMVWDNIMFRLFGLEYNPNDLSYETWQNS
IHPDDRRDGDIEIAKAISGTKNLDAQYRAVWPNGDIRHMRAIGVTQKDSNGKVVKIVGAN
YDITELKNTQMRLKESEDSFYGAFEHSNTGMAIVALDGSFEKVNQSLCDCLGYTMDELTQ
MSFLEITHPDDFKNDVHLLKQIVSGLKPSYKLEKRYIHKNGHIVYGILTATAVTDMNGKV
LHYVSQVTDITPQIRTEKKLTRLVSITSEQNERLLNFAHIVSHNLRSHSSNLSMLTNFLT
KEKNDEERKNLLTMLRGASDSLNETIMHLNEVVQVKIGAHEKKKPVNLYDTLKNVENNLS
QLIQEKNATFELKIPRDLTIKAIPAYLDSIVLNLISNGLKYSSPKRKPLIQISAELAHDA
IIISFKDNGMGIDLTRHQKKIFGMYKTFHRNKDAKGIGLFITKNQIEAMNGKIEVESTVG
VGSTFKLYFENHEHYKN
Download sequence
Identical sequences G0LAP6
gi|340617419|ref|YP_004735872.1| WP_013992793.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]