SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340617629|ref|YP_004736082.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340617629|ref|YP_004736082.1|
Domain Number 1 Region: 484-604
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.38e-20
Family Histidine kinase 0.016
Further Details:      
 
Domain Number 2 Region: 275-373
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000509
Family BphP N-terminal domain-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340617629|ref|YP_004736082.1|
Sequence length 617
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MPKDKKKLPLDSETFLSIRKWYLLALAGIAVTIIVAQILIQFHLNTQLSDSRVINLAGRQ
RANSQKLVKEALLLKEMPTSNEKRSLITSEIKKTLTVWKASQEGLQAGDAELGLPPERDK
NIIAHFHEIEPHYSAMAKAAENILRLAAKDSLAKEALGKEISVLLKNERSFLRLMDTIVN
AYDQNSKEKLQNLKRKELLLLAFSLLILVLEIGFVFRPLSIQIRKTIAQLVQNQANSEAR
AKEIEQLYAEKEKSLQELQELNFVIDNAALFASARSDGSVVFISKKFLNLLGIDQNELNK
PLSEILTADIGQQAYLREVLKSNRKNVIRSEEIKITTVKGAHFWLDMSIVPMHQSSRQQS
ILILCSDITERKENSIKVEQLTQQNFEARMLQKKVQASQIVEGQEEERKRIAKDIHDGIG
QMLTALKFNIESIDPENKEKTVEKIAYLKSLTSDLIKGVRTATFNLTPPELDDHGIFPAL
HKMTVELSKLTGKTILFDNKTDDNIRFDSLAETNVYRVVQEAVNNAIKYAEANYILITIN
YKDHILSVVIDDDGKGFDDSILNTPPQNNSEGGMGLFFMKERIDYINGRLFINSIPGEGT
RVTINYKTKKEEDHGAE
Download sequence
Identical sequences G0L4G5
WP_013993002.1.951 gi|340617629|ref|YP_004736082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]