SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340617647|ref|YP_004736100.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340617647|ref|YP_004736100.1|
Domain Number 1 Region: 8-45,84-531
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 3.49e-123
Family N-6 DNA Methylase-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340617647|ref|YP_004736100.1|
Sequence length 533
Comment type I restriction enzyme ZgaDII, M subunit [Zobellia galactanivorans]
Sequence
MAKADIDFEKELWDAANELRGAVSENNYKNYILPLVFLKHLSERFDIVKEELENTLNEPS
SEYYTTNHEEKDYVLSDPDEYRSRNTFMIPKTASWQYLKDNAEQDDIKVKVDDAFDTIQD
LLTAYNPQLNNLLPRIFVKSELSAKQTGGIINLLSHPKFSEKENPESDILGRIYEYYIGR
FAMAEGSGAGQFFTPGSIVRLLVELLEPYKGRIFDPACGSGGMFVQSLKFIKEHGGNKSD
ISIYGQEMTAQTLRLCLMNLLLRNLSFDIKLGNSLLDDKFPDLKADFVIANPPFNVSNWH
PEDLPENDTRLFGPREEFTTDGSANYMWMQTFWHHLNDRGTAGVVMANGAMTSNTKGEKN
VRQYMVDKGMIDCIVRMPDKLFLTTGIPACLFILSRNRDGKDGEHRERMNEILFIDAAKM
GKMASRKLRVFEDADIKKIADAYHAYRTVPEALEGRSLDPYQDELGFCKAATVEEVQKQD
YKLTPGIYVGTEAEEDDGIPFEEKMETLKATLLAQFEKGEKLKKQIVENFDKF
Download sequence
Identical sequences G0LB07
WP_013993020.1.951 gi|340617647|ref|YP_004736100.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]