SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340617929|ref|YP_004736382.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340617929|ref|YP_004736382.1|
Domain Number 1 Region: 116-294,421-580
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.99e-100
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000753
Further Details:      
 
Domain Number 2 Region: 2-110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.1e-29
Family Anticodon-binding domain 0.00032
Further Details:      
 
Domain Number 3 Region: 291-415
Classification Level Classification E-value
Superfamily GAD domain-like 1.53e-29
Family GAD domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340617929|ref|YP_004736382.1|
Sequence length 584
Comment aspartyl-tRNA synthetase [Zobellia galactanivorans]
Sequence
MYRSHTCGELRESDINTKVTLSGWVQKTRDKGFVVWVDLRDRYGITQLVFDEDRTSSKLL
EQARSLGREYVVQVTGEVIERTSKNPNIPTGGIEVLVDEVILLNKSKTPPFTIENETDGG
EDLRMKYRYLDIRRNPVKNNLIFRSKVSMEVRKYLSDHSFVEVETPYLIKSTPEGARDFV
VPSRMNEGQFYALPQSPQTFKQLLMVGGMDKYFQIVKCFRDEDLRADRQPEFTQIDCEMA
FVEQEDILDTFEGLTKHLLKEIKGVEISAFPRITYDDAMRIYGNDKPDIRFGMEFGELNA
VTQHKDFGVFNSAELVVGIAVPGGASYTRKELDALVNWVKRPQVGAKGMVYVKYNEDGSF
KSTVDKFYDQEDLAKWAKITEAKPGDLICVLSGDANKTRTQLSALRMELAERLGLRNPNE
FAPLWVIDFPLLELDEETGNYHAMHHPFTSPKPGQLELLETDPGAVRANAYDLVLNGNEI
GGGSIRIHDRDVQSTMFKHLGFTPEEAQAQFGFLMDAFQYGAPPHGGIAFGLDRLVSILG
GQETIRDFIAFPKNNSGRDVMIDAPAAIDQEQLHELKLKLDIEA
Download sequence
Identical sequences G0LBE1
gi|340617929|ref|YP_004736382.1| WP_013993302.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]