SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340618119|ref|YP_004736572.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618119|ref|YP_004736572.1|
Domain Number 1 Region: 120-422
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.36e-89
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000232
Further Details:      
 
Domain Number 2 Region: 1-116
Classification Level Classification E-value
Superfamily tRNA-binding arm 4.34e-23
Family Seryl-tRNA synthetase (SerRS) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340618119|ref|YP_004736572.1|
Sequence length 423
Comment seryl-tRNA synthetase, class IIa [Zobellia galactanivorans]
Sequence
MLQLQVVRDKKDDIINALKKRNIDAAPLIDEVLELDEKRRSTQTALDNTLAESNKLSKEI
GILFKTGKAQEANALKEKTGTLKEDSKKLGEELNTIAEELQRALYQIPNVPHESVPSGNT
DEDNEEVFKEGEIPVLNTDALPHWELAKKYDIIDFELGVKIAGAGFPVYKGKGARLQRAL
ISYFLDKNTEAGYTEMQVPHLVNEASGFGTGQLPDKEGQMYHVGEDDLYLIPTAEVPVTN
LFRGEIVAESDFPICYTAYTPCFRREAGSYGAHVRGLNRLHQFDKVEIVRVENPANSYHA
LDGMVEHVKNILRELKLPYRILRLCGGDLGFTSALTYDFEVFSTAQDRWLEISSVSNFET
YQANRLKLRYKDENGKSQLAHTLNGSSLALPRVLAGILENYQTPDGIQIPEVLVPYCGFD
RID
Download sequence
Identical sequences G0L5H9
WP_013993491.1.92583 WP_013993491.1.951 gi|340618119|ref|YP_004736572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]