SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340618441|ref|YP_004736894.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618441|ref|YP_004736894.1|
Domain Number 1 Region: 13-182
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.000000214
Family UbiE/COQ5-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340618441|ref|YP_004736894.1|
Sequence length 189
Comment hypothetical protein zobellia_2465 [Zobellia galactanivorans]
Sequence
MHGQPTLQAVQMYENTYPSKRFQHTLEFLRKHVSTDESILDLGVENPFSKIMKEQGYSVE
NTKGEDLDLDFSSVKASEAQVVTAFEIFEHLLAPFNTLREIKANKLVASIPLKLWFSPAY
RSKTDPWDRHYHEFEDWQFDWLLEKAGWEIKDRAKWTNPVKKIGLRPLLRSFTPRYYIVY
AEKKPIDQA
Download sequence
Identical sequences G0LC35
gi|340618441|ref|YP_004736894.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]