SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|340618547|ref|YP_004737000.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618547|ref|YP_004737000.1|
Domain Number 1 Region: 214-357
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-24
Family Histidine kinase 0.0047
Further Details:      
 
Domain Number 2 Region: 16-121
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.57e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.057
Further Details:      
 
Domain Number 3 Region: 129-202
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000726
Family Homodimeric domain of signal transducing histidine kinase 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340618547|ref|YP_004737000.1|
Sequence length 359
Comment two-component system-sensor histidine kinase [Zobellia galactanivorans]
Sequence
MNPALKAKHILLDPFFDLSMDYLCVAGFDGYFRRVNPAFVRLLGYSEADLYSKPIDNFIY
EEDRNLTALQREGLIKNRPLVNFENRYVRKSGELVWLHWTSIPLKDEQLVYAIAKDVTHK
KNMESERISHVARLSKINQQLKQLNYTTSHDLRSPVNNLLSLVEMIDCKSGKEEGNLQII
DYIKQSALGLKNSLNSYVDALKENEAETVGLGKVGLREVFEKVQGSISSLINNSKAKFCV
DFSGMESVHFNTAYMESIFLNLITNSIKYMRPDVSPEIKIISFQEQGESILTFSDNGLGF
DMDKVGGLIFNLNQRFHDTKDSKGVGLFLVHSHVTSLGGTIDVASKVNQGTTFTIKFQS
Download sequence
Identical sequences G0LC81
WP_013993917.1.951 gi|340618547|ref|YP_004737000.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]